DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG4854

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:478 Identity:138/478 - (28%)
Similarity:187/478 - (39%) Gaps:179/478 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CRVCLQQPKEPMASIFNDDS----EKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFR 83
            ||:||.|||        |:|    |.|....|:.|.||.:.:...:|::||..|..:|:.|.|.|
  Fly    12 CRICLVQPK--------DESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLR 68

  Fly    84 ETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYA 148
            ..||::...|:             |:|..|...::..|      |||.:...|..|:.       
  Fly    69 SLCQQTEKDLK-------------EQKLQEINIEIVHD------EQETKKKTESRDLS------- 107

  Fly   149 EADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYD 213
                                             |||....|                        
  Fly   108 ---------------------------------KNEATGSD------------------------ 115

  Fly   214 HEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRR 278
                    |||  |.||||  .:|...||:.      |:..:.:|.|   |:..:|.|...:...
  Fly   116 --------SEL--EYEYLD--SYDVTLESSE------DVACSADELV---SIEPAISAPEESVYS 159

  Fly   279 VNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIK 343
            ::|:                       |:.....:|..|.|                        
  Fly   160 LSPK-----------------------PVTFEDEDSGQAAS------------------------ 177

  Fly   344 TKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMN 408
                            :.|::|.|:|..:.:||.|:||||..||||||||...|.|..|||||||
  Fly   178 ----------------FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMN 226

  Fly   409 THTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHV 473
            ||||||||||.||.:.|||.|||.||.|||||||||:|:.|.::|.|:|.|:.|...||||:|..
  Fly   227 THTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFS 291

  Fly   474 CDVCGKGFPQAYKLRNHRVIHER 496
            |..|.|.|.|.:...:|...|:|
  Fly   292 CQYCQKSFSQLHHKNSHEKSHKR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 26/75 (35%)
C2H2 Zn finger 362..382 CDD:275368 8/19 (42%)
zf-H2C2_2 375..399 CDD:290200 16/23 (70%)
COG5048 386..>447 CDD:227381 46/60 (77%)
C2H2 Zn finger 390..410 CDD:275368 13/19 (68%)
zf-H2C2_2 403..426 CDD:290200 18/22 (82%)
C2H2 Zn finger 418..438 CDD:275368 12/19 (63%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 18/52 (35%)
C2H2 Zn finger 180..200 CDD:275368 8/19 (42%)
zf-H2C2_2 193..217 CDD:290200 16/23 (70%)
COG5048 201..>258 CDD:227381 41/56 (73%)
C2H2 Zn finger 208..228 CDD:275368 13/19 (68%)
zf-H2C2_2 221..244 CDD:290200 18/22 (82%)
C2H2 Zn finger 236..256 CDD:275368 12/19 (63%)
zf-H2C2_2 251..273 CDD:290200 14/21 (67%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 11/23 (48%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006293
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.