DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Odj

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:487 Identity:103/487 - (21%)
Similarity:165/487 - (33%) Gaps:154/487 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CRVCLQQ-----PKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKF 82
            ||:|.::     ||    :||...:.: :...|.:..|:.|...:..|..||..|...|..|..|
  Fly     5 CRICGERIFTPHPK----NIFEKRNHR-IRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAF 64

  Fly    83 RETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHY 147
            |:.|..::.:|         .||...|.|  .|:|..|:|.|..::...:.:..|:.||.:    
  Fly    65 RQRCLETHANL---------HQRISSKAG--VASKGSPEVSPVLSDPLLKREVLDDTVDTE---- 114

  Fly   148 AEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGY 212
                              :|..|::.:||.:...|:...:|..|:.     |...:...|.||.:
  Fly   115 ------------------DDKELLDDDKDLMDDDKDFLEDEKPILR-----YPPAKKIRIEDQNF 156

  Fly   213 DHEMADQA-LSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATK 276
            .:..:.:. :..|...:                          .|:...|....|.  |.|...|
  Fly   157 PNRQSPRVRVKRLRVPV--------------------------VEKADSPPPPPRE--HVRKPRK 193

  Fly   277 RRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSG 341
            ||..|:                  .||                  |||                 
  Fly   194 RRPKPK------------------VDR------------------SIK----------------- 205

  Fly   342 IKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARH 406
                             :|:||.||..:...|.:.:| |:....:...|:.||..|.....|..|
  Fly   206 -----------------RYVCDQCGWSFNDHSNMKDH-KLRHFEEKFSCDECGRKFYTMPLLRLH 252

  Fly   407 MNT-HTGNRPYKCSYCPAAFADLSTRNKHHR-IHTNERPYECDVCHKTFTYTNTLKFHKMIHTGE 469
            :.. |.|.:||.|.:|...||:..:|.:|.| :|.||..:.|.:|.|.|........|:..|..:
  Fly   253 IRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSD 317

  Fly   470 KP--HVCDVCGKGFPQAYKLRNH--RVIHERR 497
            :|  |:|..|.|.|.:|..|..|  ...|.:|
  Fly   318 QPDVHICLTCNKEFKEAQFLHRHYSTKYHRKR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 20/76 (26%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 6/23 (26%)
COG5048 386..>447 CDD:227381 20/62 (32%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
zf-H2C2_2 403..426 CDD:290200 8/23 (35%)
C2H2 Zn finger 418..438 CDD:275368 7/20 (35%)
zf-H2C2_2 432..455 CDD:290200 9/23 (39%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 459..481 CDD:290200 7/23 (30%)
C2H2 Zn finger 474..494 CDD:275368 7/21 (33%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 20/85 (24%)
COG5048 <202..343 CDD:227381 47/193 (24%)
C2H2 Zn finger 209..229 CDD:275368 7/20 (35%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 249..274 CDD:290200 9/24 (38%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 8/24 (33%)
C2H2 Zn finger 324..343 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.