DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG17801

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:509 Identity:118/509 - (23%)
Similarity:174/509 - (34%) Gaps:187/509 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETCQRSY 90
            ||    |.:|.|      ||||       |:.::|.:..|..||..|...|..:.|.::..||.:
  Fly    27 CL----EVLAKI------KDLT-------GIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRVH 74

  Fly    91 GH--LRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEADDA 153
            ..  ||:..|                   |:.|::...::.|||.|..|                
  Fly    75 NEATLRRESG-------------------LDEDLESTVSDIEPEGDSSD---------------- 104

  Fly   154 AETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHEMAD 218
                               ||.                 ||.|| .|.|..|             
  Fly   105 -------------------LES-----------------EESYD-SENYPFD------------- 119

  Fly   219 QALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPRR 283
                                  :.|.|.|  :|||...|:            .||...   ||..
  Fly   120 ----------------------KKAEESD--IDLNLAHED------------RRNEPH---NPYD 145

  Fly   284 SAT-----------STASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKM-------SIKSEKDIS 330
            |.|           .|.|.|.|:..:| .|..:|   ::||....|:.:       |||..|.::
  Fly   146 SETPLIFKHKNPLIETPSFANENLPNK-VDAKSP---KKGNFIQIGTDLRLLTTYPSIKVVKPLA 206

  Fly   331 IG--EVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEIC 393
            :.  :|.|......|...        :|....:|..||.::.:...|..|:..|:|.|...|..|
  Fly   207 LAPEDVAAENVPPAKRTA--------RKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFC 263

  Fly   394 GHCF-----AQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRI-HTNERPYECDVCHKT 452
            ...|     |:..:..|||    |.:|::|::|.|.|...:.::.|.|| |..:..|:||.|.|.
  Fly   264 DKRFVTKYLARLHERVRHM----GEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKR 324

  Fly   453 FTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH--RVIHERRGQSARES 504
            |.....|..||.:|:|.||..|.:|...|.:...||:|  .|.|::|..:..||
  Fly   325 FNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRASAILES 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 20/70 (29%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 8/28 (29%)
COG5048 386..>447 CDD:227381 19/66 (29%)
C2H2 Zn finger 390..410 CDD:275368 7/24 (29%)
zf-H2C2_2 403..426 CDD:290200 8/22 (36%)
C2H2 Zn finger 418..438 CDD:275368 7/20 (35%)
zf-H2C2_2 432..455 CDD:290200 10/23 (43%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 9/21 (43%)
C2H2 Zn finger 474..494 CDD:275368 7/21 (33%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 19/63 (30%)
zf-C2H2 231..252 CDD:278523 5/20 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 8/24 (33%)
C2H2 Zn finger 260..281 CDD:275368 4/20 (20%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.