DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG17806

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:504 Identity:107/504 - (21%)
Similarity:188/504 - (37%) Gaps:124/504 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86
            :||.|.|: .|...|:| |...:|:...|.:..|..::.....|.:||..|...|..|..|||.|
  Fly     4 LCRTCGQE-AEHAKSLF-DKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERC 66

  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEAD 151
            .|:  :...|           ||:|.                      :||.|.:          
  Fly    67 IRT--NSSWF-----------EKQGK----------------------QEDSDTE---------- 86

  Fly   152 DAAETQGGVFHDEIEDGI------LVELEKDRIVHVKNEQVEEDGIIEEVYD--VYETYEGDLIP 208
              ...:||  ::.:|..:      :.:.::.||:..::::|  ||:..:..:  :|.....::.|
  Fly    87 --TAREGG--NNRLESRVDVMPISIAQPQRRRILPQRSKKV--DGVPLKTVETPIYPLVVPEIPP 145

  Fly   209 DQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARN 273
                 .::.|....|...:::...|:..|...||.:.::...::....:|...:..|...:.   
  Fly   146 -----ADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQ--- 202

  Fly   274 ATKRRVNPRRS-------ATSTASVA-VESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDIS 330
              |.|..||..       ....|.:. ::|:|:||.:.....:.:.|     .:|.:...|    
  Fly   203 --KNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWG-----AAKRAYALE---- 256

  Fly   331 IGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGH 395
                             |::         |.||.||..:..:.....|::.|.|.|..:|:.|..
  Fly   257 -----------------HRL---------YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDR 295

  Fly   396 CFAQAQQLARHMN-THTGNRPYKCSYCPAAFADLSTRNKHHRIHTN---ERPYECDVCHKTFTYT 456
            .......|..|:. .|.|..||.|.||...|.:...|..|.|.|..   .||:.|..|.|.|..:
  Fly   296 MEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTS 360

  Fly   457 NTLKFHKMIHTGEKPHVCDVCGKGFPQA------YKLRNHRVIHERRGQ 499
            ..||.|.::||||:|..|::|...|.:.      ||.::||:..|.:.:
  Fly   361 TALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEEQSK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 22/72 (31%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 6/23 (26%)
COG5048 386..>447 CDD:227381 19/64 (30%)
C2H2 Zn finger 390..410 CDD:275368 4/20 (20%)
zf-H2C2_2 403..426 CDD:290200 9/23 (39%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 9/25 (36%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 7/25 (28%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 23/86 (27%)
zf-C2H2 260..282 CDD:278523 6/21 (29%)
C2H2 Zn finger 262..282 CDD:275368 5/19 (26%)
C2H2 Zn finger 290..311 CDD:275368 4/20 (20%)
COG5048 <298..>383 CDD:227381 30/84 (36%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 9/31 (29%)
C2H2 Zn finger 378..396 CDD:275368 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.