DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG6654

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:607 Identity:152/607 - (25%)
Similarity:228/607 - (37%) Gaps:160/607 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86
            :|..||.. ..|:.||::..|...|..||||......::.|:.|:|:|..|...:...:.|:..|
  Fly     6 ICLTCLSS-TGPLLSIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFKIKC 69

  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKG----------SETATKLEPD----------VDPDEAEQEP 131
            :.|...|||.: |..:.:.|..|..          :...|..|||          |...:|||..
  Fly    70 ENSSRTLRQLL-PNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNT 133

  Fly   132 EHDEEDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVY 196
            ...:....||||          .|.:|.||..|:.|. .||.....|:.|:....:|..::....
  Fly   134 SLIKSTISVDLD----------YEGEGEVFDYELPDE-PVEKTTSLILQVQGNLKDEKEVVFTQT 187

  Fly   197 DVYETYEGDLIPDQGYDHEMADQALSELS----------AEI---------------EYLDQVEH 236
            :|  .||||       |||: :|.:.|.:          |||               :.|.|.|:
  Fly   188 NV--IYEGD-------DHEL-EQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQEN 242

  Fly   237 D--QLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHA----------------------RNATKR 277
            |  |....:.|:..|:     |:|.||..:.|.|...                      |..|:|
  Fly   243 DKHQTPVGSKEEAREL-----EKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQR 302

  Fly   278 RVNPRRSAT-----STASVAVESSTSKTTDRGN-------PLKVRRGNSDSAGSKMSIKSEKDIS 330
            :::..|:.|     :|:..|.........||.|       .|.:.|...............:.:.
  Fly   303 KLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVF 367

  Fly   331 IGEVLARKHSGIKTKGGHK-----------------ILLGDKKEFKYICDVCGNMYPSQSRLTEH 378
            :......:|..  :.|.|.                 ::.|.|:..:..|::|..::...|.|.:|
  Fly   368 VSPDHLAEHQA--SHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDH 430

  Fly   379 IKVHSGVKPHECEICG----------------------------HCFAQAQQLARHMNTHTGNRP 415
            :::|:|.||..|.|||                            |.|....:|..|..||||::|
  Fly   431 MRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKP 495

  Fly   416 YKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKG 480
            ::|..|.|.|....:..||.|.||.||||.||:|...||..|.||.|:..||||:|:||..|.|.
  Fly   496 FECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKT 560

  Fly   481 FPQAYKLRNHRVIHERRGQSAR 502
            |.|    |....:|:|..|..|
  Fly   561 FTQ----RGDCQMHQRTHQGER 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 21/72 (29%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 12/51 (24%)
COG5048 386..>447 CDD:227381 28/88 (32%)
C2H2 Zn finger 390..410 CDD:275368 8/47 (17%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 13/22 (59%)
C2H2 Zn finger 446..466 CDD:275368 9/19 (47%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 22/73 (30%)
C2H2 Zn finger 331..354 CDD:275368 5/22 (23%)
COG5048 <357..570 CDD:227381 61/218 (28%)
C2H2 Zn finger 360..380 CDD:275368 1/21 (5%)
C2H2 Zn finger 385..406 CDD:275370 0/20 (0%)
C2H2 Zn finger 414..434 CDD:275368 5/19 (26%)
zf-H2C2_2 427..451 CDD:290200 10/23 (43%)
C2H2 Zn finger 442..490 CDD:275368 8/47 (17%)
C2H2 Zn finger 470..487 CDD:275368 3/16 (19%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 12/23 (52%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 539..563 CDD:290200 13/23 (57%)
C2H2 Zn finger 554..574 CDD:275368 8/23 (35%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.