DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG14711

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:499 Identity:141/499 - (28%)
Similarity:210/499 - (42%) Gaps:140/499 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KWIVCRVCLQQP--KEPMASIFNDDSE--KDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMA 79
            ::::||:||.:.  .|.||.:|:|:..  ::|...|.|.|.:.:....:.|..:|..|.:.|..|
  Fly     3 EYMLCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSA 67

  Fly    80 FKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLD- 143
            .||||.||.|                  |:..:....|         ||.:.|..:|...|..| 
  Fly    68 HKFRELCQES------------------ERTFATNVVK---------AEMKSEPTDEVPHVVADN 105

  Fly   144 -ESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLI 207
             |..|..|:|        |.|.:||.|.:|       ::..|.: ||| :.|....|||      
  Fly   106 IEYIYESAND--------FIDGVEDDIGME-------NIMEEPL-EDG-VGETSQAYET------ 147

  Fly   208 PDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVR-ASIHA 271
                             |..::.||            |||..|. |||:.::.|.:..| |.:..
  Fly   148 -----------------STVVDDLD------------EDDLLVP-NSTDSDYQPIERCRKAKVRK 182

  Fly   272 RNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLA 336
            ...|||.....|.|:|                |:|   |..:.:....:.|.||..::|...:: 
  Fly   183 TRMTKRGRGRPRGASS----------------GHP---RSFSEERPPVQASFKSSPEVSSTNIM- 227

  Fly   337 RKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQ 401
                                     |::|||:|..::.|..|::.|...||.:||||...||...
  Fly   228 -------------------------CEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPS 267

  Fly   402 QLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIH 466
            :|.||:..|||.:|:.|.||..:|||.|:..:|.|.||||||:.|..|.|.|:|:|.||.|.:.|
  Fly   268 ELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTH 332

  Fly   467 TGEKPHVCDVCGKGFPQAYKLRNH--------RVIHERRGQSAR 502
            |||||.:|.||.|.|.:.::|..|        .|||.:..::.|
  Fly   333 TGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNERTGR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 25/76 (33%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 30/60 (50%)
C2H2 Zn finger 390..410 CDD:275368 9/19 (47%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 9/19 (47%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 9/19 (47%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 8/27 (30%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 26/92 (28%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 52/112 (46%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 9/19 (47%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 14/23 (61%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.