DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG31388

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:512 Identity:108/512 - (21%)
Similarity:182/512 - (35%) Gaps:109/512 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86
            :||.|.:.....:|....|.|...:...|.....:.:|:....|..:|:.|...|::|..||..|
  Fly     4 ICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRVC 68

  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEAD 151
            ..:     |.:..:::.|...|::..|:..:...|..|||........:.::.:|.         
  Fly    69 IEA-----QELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDF--------- 119

  Fly   152 DAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEG-----DLIPDQG 211
                    :|..|.:|     ...|.:..:|....      .|..:.|::...     :|..|..
  Fly   120 --------IFDPEPQD-----KNTDELASIKTTTT------TEYMNAYQSVASPQSSPELSTDSQ 165

  Fly   212 YDHEMADQALS-ELSAEIEYLDQVEHDQLTESAH---------EDDAEVDLNSTEEEFVPSKSVR 266
            ..:|..|..|| |...|.|.:|..:    |.|:|         |:..|:.|:......:|..:..
  Fly   166 LSNEHFDMGLSPESEPESEAIDNRD----TSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKF 226

  Fly   267 ASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISI 331
            ...|.....:                   |.:..|...|.:.                       
  Fly   227 VCDHCDEGFR-------------------SAAALTRHCNMIN----------------------- 249

  Fly   332 GEVLARKHSGIKTKG--GHKILLGDKKE-------FKYICDVCGNMYPSQSRLTEHIKVHSGVKP 387
               |...||..|.|.  .:.|||...|:       .:::|.:||....:...|..|:..|:|.:.
  Fly   250 ---LPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRR 311

  Fly   388 HECEICGHCFAQAQQLARHMNTHTGNRPYKCSY-CPAAFADLSTRNKHHRIH--TNERPYECDVC 449
            |:|:.|...|..|.:|..|..|||..|||.|.| |...|...|.|:.|.|:|  .::|.|:|:.|
  Fly   312 HKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYC 376

  Fly   450 HKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARESVA 506
            .|::...:..:.|:..|...:.|.|::|...|..|...|:|...:..:...||...|
  Fly   377 PKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAA 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 16/72 (22%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 24/63 (38%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/23 (48%)
C2H2 Zn finger 418..438 CDD:275368 8/20 (40%)
zf-H2C2_2 432..455 CDD:290200 8/24 (33%)
C2H2 Zn finger 446..466 CDD:275368 4/19 (21%)
zf-H2C2_2 459..481 CDD:290200 5/21 (24%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 17/76 (22%)
C2H2 Zn finger 228..254 CDD:275368 5/70 (7%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.