DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG17359

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:507 Identity:113/507 - (22%)
Similarity:161/507 - (31%) Gaps:203/507 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQP-------KEPMASIFN-DDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKM 78
            :||||..:.       .||.||... .:.|..|..|:|||.|..:.:.|..|..||.:|.:.::.
  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRN 70

  Fly    79 AFKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPD------EAEQEPEHDEED 137
            |::.|..|::|:.:..|      :.....|....|....:..:::|.      ||.:.||..|. 
  Fly    71 AYRLRRQCRKSHQYFEQ------LRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEP- 128

  Fly   138 EDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETY 202
                                           :||||     |.||....|...|           
  Fly   129 -------------------------------LLVEL-----VQVKYMPPEPKPI----------- 146

  Fly   203 EGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRA 267
             ...:||.. :|::|                                       :.:.|:|:   
  Fly   147 -SSPLPDNN-EHKLA---------------------------------------QSYSPAKT--- 167

  Fly   268 SIHARNATKRRVNPRRSATSTASVAVESSTSKTTD--------RGNPLKVRRGNSDSAGSKMSIK 324
               ..|.:|||.   ||.:...|.:.:|......|        ||.|.:|               
  Fly   168 ---PHNKSKRRA---RSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRV--------------- 211

  Fly   325 SEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHE 389
                                                         |.               |:.
  Fly   212 ---------------------------------------------PG---------------PYR 216

  Fly   390 CEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFT 454
            |::|...|.|.|.|..||..|||.||||||.||.:||.......|.|.||.|||:.|..|.|.|.
  Fly   217 CKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFR 281

  Fly   455 YTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHER--RGQSARES 504
            ....|:.|...||||:|..|..|.:.|.|...|:.|...|.|  |..|::|:
  Fly   282 QVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQET 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 24/80 (30%)
C2H2 Zn finger 362..382 CDD:275368 1/19 (5%)
zf-H2C2_2 375..399 CDD:290200 4/23 (17%)
COG5048 386..>447 CDD:227381 29/60 (48%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 14/22 (64%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 9/21 (43%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 25/87 (29%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 15/24 (63%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.