DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF793

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001013681.2 Gene:ZNF793 / 390927 HGNCID:33115 Length:406 Species:Homo sapiens


Alignment Length:174 Identity:67/174 - (38%)
Similarity:92/174 - (52%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 GEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHC 396
            |:....|...|:.:..|   .|:|   .|.|..||..:..:|.|.:|.::|:||:|.||..||..
Human   233 GKAFCYKSEFIRHQRSH---TGEK---PYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFFCGKA 291

  Fly   397 FAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKF 461
            |.|......|..||||.||:.||.|..:|.:.|..|.|.::||.||||.|..|.|:|:..:.|..
Human   292 FTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGERPYRCRECGKSFSQKSCLNK 356

  Fly   462 HKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARESV 505
            |...||||||:.|:.|||.|.|...|..|:.||.|:.....|::
Human   357 HWRTHTGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
ZNF793NP_001013681.2 KRAB 8..68 CDD:214630
C2H2 Zn finger 190..221 CDD:275368
COG5048 <225..385 CDD:227381 62/157 (39%)
C2H2 Zn finger 229..249 CDD:275368 3/15 (20%)
C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
C2H2 Zn finger 341..361 CDD:275368 6/19 (32%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.