DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp174

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001074686.1 Gene:Zfp174 / 385674 MGIID:2686600 Length:407 Species:Mus musculus


Alignment Length:456 Identity:108/456 - (23%)
Similarity:164/456 - (35%) Gaps:114/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SIFNDDSEKDLTHMI---RECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETCQRSYGHL--RQ 95
            |...:||:|...|:|   .|..|.|  |...|||.                |..::.:.|.  ::
Mouse    10 STHTEDSDKQERHIIMKLEENRGPP--QQKAYPDP----------------ELSRQGFRHFCYQE 56

  Fly    96 FVGPVEV---------EQRPPEKKGSETATK----------LEPDVDPDEAEQEPEHDEEDEDVD 141
            ..||.|.         :...||....|...:          |.|::......:.|:...  |.|.
Mouse    57 VSGPQEALSCLQQLCRQWLQPELHTKEQILELLVMEQFLVILPPEIQAQVWHRYPKSSR--EIVT 119

  Fly   142 LDESHYAEADDAAE-----TQGGVFHDEIEDGILVELE-KDRIVHVKNEQVEEDGIIEEVYDVYE 200
            |.|..:..:....:     .||.....|.....|||.| :|......:..::||.:.|      .
Mouse   120 LVEDLHRTSKKPKQWVTVCMQGQKVLLEKTGAQLVEQELRDFQPQTPSRDIQEDSLEE------P 178

  Fly   201 TYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSV 265
            :.||.  .:|...|......|.|   .:..|.:.|..::     ..|.|   |..:||...:|:.
Mouse   179 SCEGS--HEQLSPHHWEKTVLQE---PVLRLTETESSRM-----RGDKE---NPKQEEARGAKAC 230

  Fly   266 RASIHAR--NATKRRVNPR--------------RSATSTASVAVESSTSKTTD------RGNPLK 308
            .. :|.|  ..|.....||              |...|..|:|......:..:      ||:||:
Mouse   231 TV-LHGRPKGGTLHSPEPRGVTASDARLLQWQVRPPQSPKSLAHYQKHCRELEYISNPLRGHPLR 294

  Fly   309 -VRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQ 372
             ::|    |.|.:               .|..||:....||:.....||  .|.|:.||..:...
Mouse   295 ELKR----SRGGR---------------RRSLSGLLQCLGHQAAHPAKK--PYSCEDCGKNFTWN 338

  Fly   373 SRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRI 437
            |.|..|.:||:|.:|:.|..||:||.:...|..|...|||.:||:||:|...|...|..::|||:
Mouse   339 SELKRHRRVHTGERPYICGECGNCFGRQSTLKLHQRIHTGEKPYQCSHCGKCFRQSSNLHQHHRL 403

  Fly   438 H 438
            |
Mouse   404 H 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 15/63 (24%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 22/53 (42%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 4/7 (57%)
C2H2 Zn finger 446..466 CDD:275368
zf-H2C2_2 459..481 CDD:290200
C2H2 Zn finger 474..494 CDD:275368
Zfp174NP_001074686.1 SCAN 42..152 CDD:128708 18/127 (14%)
SCAN 42..130 CDD:280241 15/105 (14%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
zf-H2C2_2 340..365 CDD:290200 11/24 (46%)
COG5048 352..>407 CDD:227381 22/53 (42%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
zf-H2C2_2 369..393 CDD:290200 11/23 (48%)
C2H2 Zn finger 384..404 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.