DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Kr

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:245 Identity:71/245 - (28%)
Similarity:111/245 - (45%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVES--STSKTTDRGNPLKVRRGNSD 315
            |||.:...|:|..           |:::.::...:..|::|..  .||     |.|:     :..
  Fly   147 NSTPQHHEPAKKA-----------RKLSVKKEFQTEISMSVNDMYHTS-----GGPI-----SPP 190

  Fly   316 SAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKK----EFKYICDVCGNMYPSQSRLT 376
            |:||..:              ..|.|   .||:...:|..|    :..:.|.:|...:..:..|.
  Fly   191 SSGSSPN--------------STHDG---AGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQ 238

  Fly   377 EHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNE 441
            .|.:.|:|.||.||..|...|.:...|..||..|||.:||.||:|...|..::...:|.|:||.|
  Fly   239 NHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGE 303

  Fly   442 RPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHR 491
            |||.|::|...|:.:|.||.|.::|.||||..|:.|...|.:.:.|.||:
  Fly   304 RPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 4/19 (21%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 26/60 (43%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 6/18 (33%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 4/19 (21%)
zf-H2C2_2 237..261 CDD:290200 10/23 (43%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
zf-H2C2_2 264..289 CDD:290200 12/24 (50%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 10/23 (43%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..345 CDD:290200 11/23 (48%)
C2H2 Zn finger 336..352 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.