DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp787

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001102374.1 Gene:Zfp787 / 365176 RGDID:1310536 Length:381 Species:Rattus norvegicus


Alignment Length:163 Identity:61/163 - (37%)
Similarity:85/163 - (52%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 YICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAA 424
            |||..||..:...|:||.|.:.|:|.:|:.|..||..|:|:..|.:|...|||.:||.||.|...
  Rat    66 YICTECGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKR 130

  Fly   425 FADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRN 489
            |:..|...:|.||||.|:||.|..|.::||.:.:|..|:..|:|.||.||..||:||.|...|..
  Rat   131 FSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCGRGFSQPKSLAR 195

  Fly   490 HRVIHE----------------RRGQSARESVA 506
            |..:|.                ||.::..|:.|
  Rat   196 HLRLHPELSGPGVAAKVLAASVRRAKAPEEATA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 26/60 (43%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
Zfp787NP_001102374.1 zf-C2H2 66..88 CDD:395048 9/21 (43%)
C2H2 Zn finger 68..88 CDD:275368 7/19 (37%)
COG5048 <93..200 CDD:227381 45/106 (42%)
C2H2 Zn finger 96..116 CDD:275368 7/19 (37%)
C2H2 Zn finger 124..144 CDD:275368 7/19 (37%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
C2H2 Zn finger 180..200 CDD:275368 8/19 (42%)
C2H2 Zn finger 282..302 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.