DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and crol

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:390 Identity:99/390 - (25%)
Similarity:152/390 - (38%) Gaps:90/390 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KNEQVEEDG-----------IIEEV------YDVYETYEGDLIPDQGYDHEMADQALSELSAEIE 229
            |:|. :|||           .||::      ::|:....||::     :|::|.....:|.....
  Fly    35 KSEH-KEDGKPPHGIEMYKVNIEDISQLFTYHEVFGKIHGDVV-----NHQLAAAHGGQLPPPPP 93

  Fly   230 YLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVE 294
            ...||.....:.:|....|..: |:.....:.|.:..|:..|..:....:.|..|......|.|.
  Fly    94 LPPQVTSHAASAAAAAAAASTN-NAAVAAVMASANAAAAAAAAASAGGGLPPATSGNGGQQVTVT 157

  Fly   295 SSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDI-----------SIGEVLARKHSGIKTKGGH 348
            :::|.|:..|:  ....|.:.:||..:..|.|..|           ..|:.:|....|.....|.
  Fly   158 TTSSSTSSGGS--TTSGGTTTTAGELLMPKMEGGIHGVDGSGNGGNGGGQNVALAPDGTPIATGT 220

  Fly   349 KI--LLGDKKEFKY---------------ICDVCG----------------------------NM 368
            .:  :.|...:|:|               :|.|||                            |:
  Fly   221 HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNV 285

  Fly   369 YPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNK 433
            :.:.:.|..|:|.||..||..|.||...||:.:.|..|..:|||..|::|.||...|........
  Fly   286 FANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVN 350

  Fly   434 HHRIHTNERPYECDVCHKTFT----YTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            |.|.||.|.|:.||:|.|:||    |.|    |.|.|||:.||.||||||.:.:...|.||...|
  Fly   351 HVRKHTGETPHRCDICKKSFTRKEHYVN----HYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSH 411

  Fly   495  494
              Fly   412  411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 8/47 (17%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 23/60 (38%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 12/26 (46%)
C2H2 Zn finger 446..466 CDD:275368 10/23 (43%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 9/19 (47%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 3/19 (16%)
C2H2 Zn finger 251..271 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..299 CDD:275368 4/19 (21%)
COG5048 300..723 CDD:227381 49/116 (42%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 10/23 (43%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..439 CDD:275368
C2H2 Zn finger 447..467 CDD:275368
C2H2 Zn finger 475..495 CDD:275368
C2H2 Zn finger 503..523 CDD:275368
C2H2 Zn finger 531..551 CDD:275368
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.