DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG15436

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:479 Identity:111/479 - (23%)
Similarity:179/479 - (37%) Gaps:141/479 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQPKEPMASIFNDDSEK----DLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKF 82
            :||||:....: :.:||  |:.:    .:..||.:|.|..:|:.|.:.:.||.:|::.:|.|:..
  Fly     4 ICRVCMDISGK-LVNIF--DARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGI 65

  Fly    83 RETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHY 147
            |:||:.|:    ||...|..|       |.|.|...       ..|:|.....||||..:|.:..
  Fly    66 RQTCEESH----QFYCRVRDE-------GIEDALCA-------LLEEEDWEISEDEDARIDSASA 112

  Fly   148 AEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGY 212
            |:.|..::::...|             :.|..|.|             |....|:          
  Fly   113 ADDDGKSDSKKVAF-------------ECRECHKK-------------YQRKGTF---------- 141

  Fly   213 DHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKR 277
                                 :.|.:    .|.|.........:..|....:::|.:...||.| 
  Fly   142 ---------------------LRHMR----THMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAK- 180

  Fly   278 RVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGI 342
               |...:....:.|.:|                          :::|.:         |.|:| 
  Fly   181 ---PYECSHCAKTFAQQS--------------------------TLQSHE---------RTHTG- 206

  Fly   343 KTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHM 407
                        ::.||  |..|...:...|.|..||:.|...:|.:|..|...|.:...|..|.
  Fly   207 ------------ERPFK--CSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHF 257

  Fly   408 NTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPH 472
            .:|||.||:|||:||.|||......:|.|:|..:||:.|..|.|||..::|||.||::|..|:..
  Fly   258 RSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTF 322

  Fly   473 VCDVCGKGFPQAYKLRNHRV-IHE 495
            .|..|...:.|...|..|.: ||:
  Fly   323 KCPHCASFYKQRKTLARHILEIHK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 22/76 (29%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 418..438 CDD:275368 9/19 (47%)
zf-H2C2_2 432..455 CDD:290200 10/22 (45%)
C2H2 Zn finger 446..466 CDD:275368 10/19 (53%)
zf-H2C2_2 459..481 CDD:290200 8/21 (38%)
C2H2 Zn finger 474..494 CDD:275368 5/20 (25%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 24/80 (30%)
C2H2 Zn finger 128..148 CDD:275368 6/67 (9%)
C2H2 Zn finger 156..176 CDD:275368 2/19 (11%)
COG5048 <180..341 CDD:227381 57/214 (27%)
C2H2 Zn finger 184..204 CDD:275368 4/54 (7%)
zf-H2C2_2 197..219 CDD:290200 8/45 (18%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..249 CDD:290200 8/24 (33%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 10/19 (53%)
C2H2 Zn finger 324..341 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.