DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG31441

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:493 Identity:114/493 - (23%)
Similarity:178/493 - (36%) Gaps:172/493 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVC---LQQPKEPMASIFNDDSE------KDLTHMIRECGGVPIKQFD-HYPDKICEKCFKVL 76
            :||.|   :...:.....:||..:.      :::|.|..|        || ..|..||:.|...|
  Fly     7 ICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLE--------FDTTLPHLICQCCKVQL 63

  Fly    77 KMAFKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVD 141
            .....||..|...:   :.|:.   ..::...||........:|||   |..|:...|..|:::.
  Fly    64 DRILTFRNKCLEVH---KSFMA---ANRKLLRKKAIVDEELDKPDV---EKLQQDLWDHTDQEMC 119

  Fly   142 LDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDL 206
            :     |.||.|     |:..::..|.   |..||.....:||:.:|:.:               
  Fly   120 V-----AMADTA-----GLLREDHNDN---EKAKDAEDATQNEKNQEEQV--------------- 156

  Fly   207 IPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHA 271
                        |..:|         :|||.|  |..|...            :.||.|.|.:..
  Fly   157 ------------QVQTE---------EVEHCQ--EQLHNMS------------IISKGVSARVPK 186

  Fly   272 RNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLA 336
            |  |||                                   ||.|                    
  Fly   187 R--TKR-----------------------------------NSKS-------------------- 194

  Fly   337 RKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQ 401
                                   :.||.||.::.|.:.|..|::.|||.||..|:||...:....
  Fly   195 -----------------------WFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDN 236

  Fly   402 QLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIH 466
            ::.||...||..|||.|.:|...:...|::..|.|.||||||::|..|.|.||.|:|.:.|:|:|
  Fly   237 EMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLH 301

  Fly   467 TGEKPHVCDVCGKGFPQAYKLRNHR--VIHERRGQSAR 502
            |.::.:.|::|.:.|.::..|..|:  .:|:||.:|||
  Fly   302 TNQRKYHCEICDQWFLRSSHLTLHQSTKLHQRRAESAR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 18/82 (22%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 23/60 (38%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 9/19 (47%)
zf-H2C2_2 459..481 CDD:290200 6/21 (29%)
C2H2 Zn finger 474..494 CDD:275368 5/21 (24%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 19/85 (22%)
COG5048 <174..337 CDD:227381 63/254 (25%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 268..290 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 9/19 (47%)
C2H2 Zn finger 309..328 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457872
Domainoid 1 1.000 42 1.000 Domainoid score I8439
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.