DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and CG11696

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:530 Identity:106/530 - (20%)
Similarity:188/530 - (35%) Gaps:119/530 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IVCRVCLQQPKEPMASIFNDD------SEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMA 79
            ::||:||:. .|....||..:      :.:.|..:|.....:.:.:.|.....:|.:|:      
  Fly     1 MICRLCLED-AEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCW------ 58

  Fly    80 FKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDE 144
                    |....:.||...|..:||... :..:..|:| |:: |:..|.||.....:.:..::.
  Fly    59 --------RQLAEIEQFCSMVAEKQRSLH-RSLQLKTEL-PEL-PELTEPEPALVVWNTESPIEP 112

  Fly   145 SHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPD 209
            ....|.||            |:|.||.|    .::...:...|:|.      |..:|:|.|..|:
  Fly   113 KLSYEGDD------------IKDHILCE----PVIDALSAGDEKDS------DYGDTFEPDFEPE 155

  Fly   210 QGYDHEMADQ---------------ALSE----LSAEIEYLDQVEHDQLTE-------------- 241
            ...|.|...:               ||.:    :..:.|...|....::||              
  Fly   156 SQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELK 220

  Fly   242 ---SAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDR 303
               :..|||.:.|.:..:||.|..:....:........:|..|:.....||.         ..|.
  Fly   221 RSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTAD---------DNDD 276

  Fly   304 GNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICD----- 363
            .:.:.|:|.:.......::...:.|.:|........:.:            |:.|:...|     
  Fly   277 TSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDL------------KRHFRVEHDCTGYV 329

  Fly   364 -VCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHM-NTHTGNRP--YKCSYCPAA 424
             .|.|.|..::...:|:..|...:...|:.|...|........|| ..|:..:.  ::|:.|.|.
  Fly   330 KCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEAR 394

  Fly   425 FADLSTRNKHHRIHT-NERPYECDVCHKTFTYTNTLKFH-KMIHTGE-KPHVCDVCGKGFPQAYK 486
            ||.......|.:.|. .|||..||.|.|||.....|..| |.:|..: .|.:||:||..|    :
  Fly   395 FAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHF----R 455

  Fly   487 LRNHRVIHER 496
            .:.:.:||::
  Fly   456 SKANFLIHKK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 13/78 (17%)
C2H2 Zn finger 362..382 CDD:275368 5/25 (20%)
zf-H2C2_2 375..399 CDD:290200 5/23 (22%)
COG5048 386..>447 CDD:227381 16/64 (25%)
C2H2 Zn finger 390..410 CDD:275368 5/20 (25%)
zf-H2C2_2 403..426 CDD:290200 6/25 (24%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/23 (48%)
C2H2 Zn finger 446..466 CDD:275368 9/20 (45%)
zf-H2C2_2 459..481 CDD:290200 9/23 (39%)
C2H2 Zn finger 474..494 CDD:275368 5/19 (26%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 18/90 (20%)
C2H2 Zn finger 332..349 CDD:275368 4/16 (25%)
C2H2 Zn finger 357..378 CDD:275368 5/20 (25%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 9/20 (45%)
C2H2 Zn finger 447..465 CDD:275368 7/21 (33%)
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.