DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp771

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_008758154.1 Gene:Zfp771 / 308992 RGDID:1305903 Length:358 Species:Rattus norvegicus


Alignment Length:412 Identity:107/412 - (25%)
Similarity:148/412 - (35%) Gaps:128/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEADDAAETQGGVFHDEIEDGI 169
            ||..:.|:..|..|..|... ..||:.|.:||:                                
  Rat    23 RPSPRPGAARAPNLGLDTKM-PGEQQAEEEEEE-------------------------------- 54

  Fly   170 LVELEKDRIVHVKNEQVEEDGIIEEVYDVY---------ETYEGDLIP--DQGYDHEMAD--QAL 221
              |::::.::.||.|  ||:|  ||.|:|.         |......:|  |....|...|  :|.
  Rat    55 --EMQEEMVLLVKGE--EEEG--EEKYEVVKLKSPVDNKEVASQMPVPSADPARPHACPDCGRAF 113

  Fly   222 SELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRR------VN 280
            :..|.            |.:.|.....|.....||.....|:....:.|.|..|..|      .:
  Rat   114 ARRST------------LAKHARTHTGERPFACTECGRCFSQKSALTKHGRTHTGERPYQCPECD 166

  Fly   281 PRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTK 345
            .|.||.|.                  |:..|                         |:|:|    
  Rat   167 KRFSAASN------------------LRQHR-------------------------RRHTG---- 184

  Fly   346 GGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTH 410
                       |..|.|..||..:...|...:|::||:|.||:.|..||..|..:..||||..||
  Rat   185 -----------EKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDCGRAFGGSSCLARHRRTH 238

  Fly   411 TGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCD 475
            ||.|||.|:.|...||..|...||.|:||.|:|:.|.||.:.|.:.:.|..|...||||:|:.|.
  Rat   239 TGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRFGHRSNLAEHARTHTGERPYPCT 303

  Fly   476 VCGKGFPQAYKLRNHRVIHERR 497
            .||:.|..:.....||..|.||
  Rat   304 ECGRRFRLSSHFIRHRRAHMRR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 29/60 (48%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
Zfp771XP_008758154.1 COG5048 <82..286 CDD:227381 69/273 (25%)
C2H2 Zn finger 106..126 CDD:275368 5/31 (16%)
zf-H2C2_2 119..143 CDD:290200 5/23 (22%)
C2H2 Zn finger 134..154 CDD:275368 5/19 (26%)
zf-H2C2_2 146..170 CDD:290200 5/23 (22%)
C2H2 Zn finger 162..182 CDD:275368 7/62 (11%)
zf-H2C2_2 174..199 CDD:290200 10/82 (12%)
C2H2 Zn finger 190..210 CDD:275368 5/19 (26%)
zf-H2C2_2 202..225 CDD:290200 9/22 (41%)
C2H2 Zn finger 218..238 CDD:275368 8/19 (42%)
zf-H2C2_2 231..255 CDD:290200 14/23 (61%)
C2H2 Zn finger 246..266 CDD:275368 8/19 (42%)
zf-H2C2_2 258..281 CDD:290200 10/22 (45%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 286..309 CDD:290200 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.