DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ace2

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:60/259 - (23%)
Similarity:97/259 - (37%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 HEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNST-EEEFVPSKSVRASIHARNATKR 277
            |....:|.::||:..||:.:.|..........|.:..::|:| .::|..|....:.|    .||:
pombe   308 HTDNQKAFAKLSSPAEYVSEFEKFSSVCDHGLDISNANINNTLTQQFALSAPYESCI----VTKK 368

  Fly   278 -----RVNPRRSATSTASVAVESSTSKTTDRGN--PLKVRRGNSDSAGSKMSIKSEKDISI-GEV 334
                 .|............|..|.|.:.|:..:  |:::    |.....|...:|.:...| .|.
pombe   369 PEPCITVKEEEQLAPKIESADLSITPQVTEHDSKPPVRI----SYDHRCKTRKQSTRICRIPPET 429

  Fly   335 LARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQ 399
            :|..:.|.:..|            ||:|                  :::|        |....|:
pombe   430 MASLYCGPEADG------------KYVC------------------LYNG--------CNKRIAR 456

  Fly   400 AQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHK 463
            ...:..|:.||..:|||:|..|.|.|.......:|.|||.|.|||.|: |.|.|...:.|..||
pombe   457 KYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENGRPYVCE-CLKRFNRLDALNRHK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 1/19 (5%)
zf-H2C2_2 375..399 CDD:290200 2/23 (9%)
COG5048 386..>447 CDD:227381 20/60 (33%)
C2H2 Zn finger 390..410 CDD:275368 3/19 (16%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 7/18 (39%)
zf-H2C2_2 459..481 CDD:290200 3/5 (60%)
C2H2 Zn finger 474..494 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 58/256 (23%)
C2H2 Zn finger 448..467 CDD:275368 4/26 (15%)
zf-C2H2 473..495 CDD:278523 7/21 (33%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..511 CDD:290200 12/24 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.