DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and 5730507C01Rik

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001188259.1 Gene:5730507C01Rik / 236366 MGIID:1917882 Length:416 Species:Mus musculus


Alignment Length:169 Identity:67/169 - (39%)
Similarity:88/169 - (52%) Gaps:17/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 RKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQ 401
            |.|:|               |..|.|..||..:...|.|..|.:.|:|.||:||..||..|:|..
Mouse   244 RTHTG---------------EKPYECHQCGKAFARLSSLHCHKRTHTGEKPYECNQCGKAFSQPS 293

  Fly   402 QLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIH 466
            .|..|..||||.:||:|:.|..|||:||...:|.|.||.|:||||:.|.|.|...|.|:.|:..|
Mouse   294 HLQSHKRTHTGEKPYECNQCGKAFAELSNLQRHKRTHTGEKPYECNQCGKAFAGHNVLQSHQRTH 358

  Fly   467 TGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARESV 505
            |||||:.|:.|||.|.....|:.|:..|  .|:..|..:
Mouse   359 TGEKPYECNQCGKAFAGHICLQYHKRTH--NGEKPRNVI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 31/60 (52%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 9/19 (47%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
5730507C01RikNP_001188259.1 KRAB 69..>110 CDD:214630
KRAB 69..106 CDD:279668
COG5048 <119..293 CDD:227381 21/63 (33%)
C2H2 Zn finger 142..162 CDD:275368
C2H2 Zn finger 171..190 CDD:275368
zf-H2C2_2 182..206 CDD:290200
C2H2 Zn finger 198..218 CDD:275368
zf-H2C2_2 210..235 CDD:290200
COG5048 <222..374 CDD:227381 61/144 (42%)
C2H2 Zn finger 226..246 CDD:275368 1/1 (100%)
zf-H2C2_2 238..263 CDD:290200 8/33 (24%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 270..291 CDD:290200 10/20 (50%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..330 CDD:275368 9/19 (47%)
zf-H2C2_2 322..346 CDD:290200 11/23 (48%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
zf-H2C2_2 351..374 CDD:290200 12/22 (55%)
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
C2H2 Zn finger 393..414 CDD:275368 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.