| Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766351.3 | Gene: | Zfp809 / 235047 | MGIID: | 2143362 | Length: | 402 | Species: | Mus musculus |
| Alignment Length: | 249 | Identity: | 70/249 - (28%) |
|---|---|---|---|
| Similarity: | 108/249 - (43%) | Gaps: | 37/249 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 283 RSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGS---KMSIKSEKDISIGEVLARKHSGIKT 344
Fly 345 ----------------------KGGHKILLGDKKEFK-----------YICDVCGNMYPSQSRLT 376
Fly 377 EHIKVHSGVKP-HECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTN 440
Fly 441 ERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
| C2H2 Zn finger | 362..382 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 375..399 | CDD:290200 | 11/24 (46%) | ||
| COG5048 | 386..>447 | CDD:227381 | 22/61 (36%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 432..455 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 459..481 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 474..494 | CDD:275368 | 7/19 (37%) | ||
| Zfp809 | NP_766351.3 | KRAB | 4..64 | CDD:214630 | |
| KRAB | 4..43 | CDD:279668 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 118..139 | 3/20 (15%) | |||
| COG5048 | <125..348 | CDD:227381 | 58/195 (30%) | ||
| C2H2 Zn finger | 157..178 | CDD:275368 | 3/20 (15%) | ||
| C2H2 Zn finger | 186..206 | CDD:275368 | 10/19 (53%) | ||
| zf-C2H2 | 213..235 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 215..235 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 227..252 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 243..263 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 255..280 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 271..291 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 284..308 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 299..319 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 151 | 1.000 | Inparanoid score | I4340 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||