DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zscan22

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001001447.1 Gene:Zscan22 / 232878 MGIID:2443312 Length:496 Species:Mus musculus


Alignment Length:459 Identity:115/459 - (25%)
Similarity:166/459 - (36%) Gaps:177/459 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LRQFVGPVEVEQRPPE----------KKGSETA------TKL------EPDVDPDEAEQEPEHDE 135
            |.||:|.:     |||          |.|.|.|      |:|      ||.|:.:||..:..:.:
Mouse    94 LEQFLGAL-----PPEIQAWVGAQCPKSGKEAAVLVEDMTQLLDRRGWEPGVEREEASCKQSNTD 153

  Fly   136 EDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYE 200
                                                |||..::                   ..|
Mouse   154 ------------------------------------ELEPPKM-------------------ATE 163

  Fly   201 TYEGDLIPDQGYDHEMADQALSELSAEIEYL--------------------------DQVEHDQL 239
            |..|.::|.....|....::.||  ::.|:|                          ||..|:..
Mouse   164 TVMGSVLPKSTLAHTCKPESHSE--SQPEFLGALWMKSTAQEMDFRKALGPHMDAPKDQPGHESN 226

  Fly   240 TES---------AHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVES 295
            |..         ..:|.|     |:||:|.|...        |.|   |.|     .|.|   |.
Mouse   227 TSGNGSNMWPNFPSQDKA-----SSEEKFGPLLD--------NET---VPP-----DTCS---EK 267

  Fly   296 STSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKY 360
            .:||.::                   .:|:.::.|..|...:.||               ::..|
Mouse   268 KSSKDSE-------------------CLKTFQNTSALEAHQKSHS---------------QKTPY 298

  Fly   361 ICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAF 425
            .|..||.::...:.|.:|..||:|.|||.|:.||..|::...|.:|:..|||.:||||..|...|
Mouse   299 ACTECGKVFSRSTHLVQHQVVHTGAKPHACKECGKAFSRVAHLTQHLRIHTGEKPYKCEECGKTF 363

  Fly   426 ADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH 490
            :..:...:|.|:||.|||||||.|.|.|:.:..|..|:.|||||||:.||||||.|.....|..|
Mouse   364 SRSTHLTQHQRVHTGERPYECDTCGKAFSQSTHLTQHQRIHTGEKPYRCDVCGKAFSDCSALVRH 428

  Fly   491 RVIH 494
            ..:|
Mouse   429 LRVH 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 1/1 (100%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 15/21 (71%)
C2H2 Zn finger 474..494 CDD:275368 9/19 (47%)
Zscan22NP_001001447.1 SCAN 45..129 CDD:366881 11/39 (28%)
COG5048 <181..479 CDD:227381 89/312 (29%)
C2H2 Zn finger 273..292 CDD:275368 3/37 (8%)
C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
C2H2 Zn finger 356..376 CDD:275368 5/19 (26%)
C2H2 Zn finger 384..404 CDD:275368 7/19 (37%)
C2H2 Zn finger 412..432 CDD:275368 9/19 (47%)
C2H2 Zn finger 440..460 CDD:275368
C2H2 Zn finger 468..488 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.