| Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011244722.1 | Gene: | Zfp13 / 22654 | MGIID: | 99159 | Length: | 546 | Species: | Mus musculus |
| Alignment Length: | 264 | Identity: | 82/264 - (31%) |
|---|---|---|---|
| Similarity: | 114/264 - (43%) | Gaps: | 38/264 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 247 DAEVDLNSTEEEFVP-----SKSVRA-------SIHARNATKRRVNPRRSATSTASVAVESSTSK 299
Fly 300 TTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKK----EFKY 360
Fly 361 ICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAF 425
Fly 426 ADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH 490
Fly 491 RVIH 494 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
| C2H2 Zn finger | 362..382 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 375..399 | CDD:290200 | 12/23 (52%) | ||
| COG5048 | 386..>447 | CDD:227381 | 28/60 (47%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 432..455 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 459..481 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 474..494 | CDD:275368 | 7/19 (37%) | ||
| Zfp13 | XP_011244722.1 | KRAB | 124..179 | CDD:214630 | |
| C2H2 Zn finger | 302..322 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 314..339 | CDD:372612 | 7/40 (18%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/29 (21%) | ||
| zf-H2C2_2 | 342..367 | CDD:372612 | 5/24 (21%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | <360..520 | CDD:227381 | 60/159 (38%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 414..434 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 442..462 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 470..490 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 151 | 1.000 | Inparanoid score | I4340 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||