DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZSCAN4

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001371762.1 Gene:ZSCAN4 / 201516 HGNCID:23709 Length:433 Species:Homo sapiens


Alignment Length:399 Identity:83/399 - (20%)
Similarity:142/399 - (35%) Gaps:104/399 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 EDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDL 252
            |:||.|....|..:::              |...|....|::.|.::.|..|....|..|..:.|
Human    36 EEGISEFSRMVLNSFQ--------------DSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISL 86

  Fly   253 ----------------------------------NSTEEEFVPSKSVRASIHARNATKRRVNPRR 283
                                              :.|::...|...|...:..:.|......|.|
Human    87 LVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQEALFSEDMPLR 151

  Fly   284 SATSTASVAVESSTSKTTDRGNP--------LKVRRG--------NSDSAGSKM--SIKSEKDIS 330
            ......:..|.:.|::..:.|.|        |:..:|        ||.|..:::  :|.::.:..
Human   152 DVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQI 216

  Fly   331 IGEVLARKHSGIKTKGG------------HKILLGDKKE-------FKYICDVCGNMYPSQ---- 372
            :..::.::.:|.:.:.|            .:::....:|       |:.:..|.|....||    
Human   217 VSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQS 281

  Fly   373 ---SRLTE-----------HIKVHSGV-KPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCP 422
               |.||.           |.|...|| |.::||.|...|.....|..|...|...||:.|..|.
Human   282 SPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQ 346

  Fly   423 AAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKL 487
            ..|..:|....|..|||.::|:.|.:|.|:|::...|:.|:.|||||||:.|..|...:.|:...
Human   347 KGFFQISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTY 411

  Fly   488 RNHRVIHER 496
            ..|...||:
Human   412 HRHMRTHEK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 9/37 (24%)
zf-H2C2_2 375..399 CDD:290200 11/35 (31%)
COG5048 386..>447 CDD:227381 19/60 (32%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 7/22 (32%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 9/22 (41%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 11/21 (52%)
C2H2 Zn finger 474..494 CDD:275368 4/19 (21%)
ZSCAN4NP_001371762.1 SCAN 40..124 CDD:153421 11/97 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..210 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..301 5/25 (20%)
zf-C2H2 312..334 CDD:395048 6/21 (29%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
zf-C2H2 368..390 CDD:395048 6/21 (29%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
zf-H2C2_2 382..407 CDD:404364 11/24 (46%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.