DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and K11D2.4

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001040677.2 Gene:K11D2.4 / 187291 WormBaseID:WBGene00010770 Length:458 Species:Caenorhabditis elegans


Alignment Length:279 Identity:73/279 - (26%)
Similarity:116/279 - (41%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNA-------TKRRV--NPRRS------AT 286
            |.:|.::....|...:.|:.:.   .::||.::.||..       .||.:  :||.|      |.
 Worm    60 DGVTAASSTAAAAAGMTSSIDN---HRTVREALLAREGHQQQQMMVKREMTESPRFSPPMGFDAP 121

  Fly   287 STASV-AVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKI 350
            :||:| :||..::.:......:|...|...|...:.:.....|.....::...|  :...|.|..
 Worm   122 TTAAVTSVEGLSALSVVGTMMMKQEHGGGASNAPQPTPTHFTDFDYMNMMQPIH--LAAIGRHSS 184

  Fly   351 LLGDKKEFKYICDVCGNMYP----SQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHT 411
            ..|.::.......|.....|    .:||.|     |.|:.  :|:.|.........|.|||:...
 Worm   185 QGGSERHLSTESSVTQAPAPVPTTKRSRST-----HDGLM--KCQYCPKKVNSEAALERHMSECR 242

  Fly   412 GNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDV 476
            ..||::|..|...|.......:|.|||.||:.|.|..|.|:||..:.|..|:.||||.||.:|..
 Worm   243 MIRPHECDRCGKRFKARGGLQQHMRIHNNEKAYVCTFCAKSFTQKSHLDQHERIHTGVKPFLCAF 307

  Fly   477 CGKGFPQAYKLRNHRVIHE 495
            ||:.|.|    |:.::.||
 Worm   308 CGRSFRQ----RSQQIGHE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 5/23 (22%)
zf-H2C2_2 375..399 CDD:290200 5/23 (22%)
COG5048 386..>447 CDD:227381 18/60 (30%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 8/22 (36%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 11/21 (52%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
K11D2.4NP_001040677.2 C2H2 Zn finger 221..241 CDD:275368 6/19 (32%)
C2H2 Zn finger 249..269 CDD:275368 5/19 (26%)
zf-H2C2_2 262..286 CDD:290200 11/23 (48%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
zf-H2C2_2 289..314 CDD:290200 12/24 (50%)
C2H2 Zn finger 305..325 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.