| Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_509284.2 | Gene: | unc-98 / 181020 | WormBaseID: | WBGene00006827 | Length: | 310 | Species: | Caenorhabditis elegans |
| Alignment Length: | 306 | Identity: | 61/306 - (19%) |
|---|---|---|---|
| Similarity: | 104/306 - (33%) | Gaps: | 103/306 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 234 VEHDQLTESAHE-DDAEVDLNSTEEEFVPSKSVRAS--IH-----------ARNATKRRVNPR-- 282
Fly 283 -RSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKG 346
Fly 347 GHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHT 411
Fly 412 GNRPYKCSYCPAAFADLSTRNKHHRIHTNE----------------------------------- 441
Fly 442 -----------------RPYECDVCHKTFTYTNTLKFHKMIHTGEK 470 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
| C2H2 Zn finger | 362..382 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 375..399 | CDD:290200 | 8/23 (35%) | ||
| COG5048 | 386..>447 | CDD:227381 | 21/112 (19%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 432..455 | CDD:290200 | 8/74 (11%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 459..481 | CDD:290200 | 6/12 (50%) | ||
| C2H2 Zn finger | 474..494 | CDD:275368 | |||
| unc-98 | NP_509284.2 | C2H2 Zn finger | 115..135 | CDD:275368 | 5/19 (26%) |
| C2H2 Zn finger | 143..163 | CDD:275368 | 8/19 (42%) | ||
| SFP1 | <169..268 | CDD:227516 | 16/101 (16%) | ||
| C2H2 Zn finger | 171..189 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 248..268 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||