DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF570

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001287922.1 Gene:ZNF570 / 148268 HGNCID:26416 Length:592 Species:Homo sapiens


Alignment Length:474 Identity:122/474 - (25%)
Similarity:187/474 - (39%) Gaps:118/474 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEA----------- 150
            |.||.||        |..||.:         .||...:||...|.|.::.|.|.           
Human    33 VTPVRVE--------SSEATAI---------SQEKSQEEERMAVGLLKAMYQELVTFRDVAVDFS 80

  Fly   151 ----DDAAETQGGVFHDEIEDG--ILVEL----EKDRIV----------HVKNEQVEEDGIIEEV 195
                |....:|..::.:.:.:.  |||.|    .|..::          .||.|..:  |:....
Human    81 QEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKPSVILLLEQGKAPWMVKRELTK--GLCSGW 143

  Fly   196 YDVYETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTES------------------ 242
            ..:.||.|  |.|.|.:..|...|.:.|.....    .:|:..|.|.                  
Human   144 EPICETEE--LTPKQDFYEEHQSQKIIETLTSY----NLEYSSLREEWKCEGYFERQPGNQKACF 202

  Fly   243 -----AHE----DDAEVDLNS----------TEEEFVPSKSVRASIHARNATKRRVNPRRSATST 288
                 .||    |:.|.:..|          ..::.:|.:.   .:|..:..||.......|...
Human   203 KEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQKIIPKEE---KVHKHDTQKRSFKKNLMAIKP 264

  Fly   289 ASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSI--------KSEKDISIGEVLARKHSGIKTK 345
            .||..|....|..|.....        |..|.:::        |..|.|..|:..:::.:.::.:
Human   265 KSVCAEKKLLKCNDCEKVF--------SQSSSLTLHQRIHTGEKPYKCIECGKAFSQRSNLVQHQ 321

  Fly   346 GGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTH 410
               :|..|:|   .|.|..|...:...:.|.:|::||:|.||:||::|...|:|...||:|...|
Human   322 ---RIHTGEK---PYECKECRKAFSQNAHLVQHLRVHTGEKPYECKVCRKAFSQFAYLAQHQRVH 380

  Fly   411 TGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCD 475
            ||.:||:|..|..||::.|:..:|.|:||.|:||||:||.|.|:....|..|:.|||||:|:.|.
Human   381 TGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYECNVCGKAFSLRAYLTVHQRIHTGERPYECK 445

  Fly   476 VCGKGFPQAYKLRNHRVIH 494
            .|||.|.|...|..|:.||
Human   446 ECGKAFSQNSHLAQHQRIH 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 4/19 (21%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 28/60 (47%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 13/22 (59%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
ZNF570NP_001287922.1 KRAB 70..130 CDD:214630 7/59 (12%)
C2H2 Zn finger 276..296 CDD:275368 3/27 (11%)
zf-H2C2_2 288..313 CDD:316026 4/24 (17%)
C2H2 Zn finger 304..324 CDD:275368 2/22 (9%)
COG5048 <307..572 CDD:227381 63/164 (38%)
C2H2 Zn finger 332..352 CDD:275368 4/19 (21%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 416..436 CDD:275368 7/19 (37%)
C2H2 Zn finger 444..464 CDD:275368 8/19 (42%)
C2H2 Zn finger 472..492 CDD:275368
C2H2 Zn finger 500..520 CDD:275368
C2H2 Zn finger 528..548 CDD:275368
C2H2 Zn finger 556..576 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.