Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001307300.2 | Gene: | ZNF582 / 147948 | HGNCID: | 26421 | Length: | 517 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 71/196 - (36%) |
---|---|---|---|
Similarity: | 99/196 - (50%) | Gaps: | 19/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 337 RKHSGIK----------------TKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGV 385
Fly 386 KPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCH 450
Fly 451 KTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARESVAGLVSYDTAN 515
Fly 516 I 516 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
C2H2 Zn finger | 362..382 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 375..399 | CDD:290200 | 11/23 (48%) | ||
COG5048 | 386..>447 | CDD:227381 | 28/60 (47%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 432..455 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 459..481 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 8/19 (42%) | ||
ZNF582 | NP_001307300.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |