DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF572

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_689625.2 Gene:ZNF572 / 137209 HGNCID:26758 Length:529 Species:Homo sapiens


Alignment Length:377 Identity:103/377 - (27%)
Similarity:158/377 - (41%) Gaps:62/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 VELEKDRIVHVKNEQVEEDGI------------IEEVYDVYETYEGDLIPD-----------QGY 212
            :|.||..:|...|..:|.:.:            :|.|:  :...:.|.:.:           |.|
Human     1 MEQEKKLLVSDSNSFMERESLKSPFTGDTSMNNLETVH--HNNSKADKLKEKPSEWSKRHRPQHY 63

  Fly   213 DHEMA-DQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATK 276
            .||.| :..|:.:..||...|..|.|..:|:.....|:.:.....:|:...:...|.:...::..
Human    64 KHEDAKEMPLTWVQDEIWCHDSYESDGKSENWGNFIAKEEEKPNHQEWDSGEHTNACVQQNSSFV 128

  Fly   277 RRVNPRRSATSTASVAVESSTSKTTDRG-NPLKVRRGNSDSAGSKMSIK------SEKDISIGE- 333
            .|.........:.|.:....|.:.|..| .|.|..........|...|:      .||....|| 
Human   129 DRPYKCSECWKSFSNSSHLRTHQRTHSGEKPYKCSECAKCFCNSSHLIQHLRMHTGEKPYQCGEC 193

  Fly   334 -----------VLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKP 387
                       :..|.|:|               |..|.|..||..:.|.|.|.:|.:.|:|.||
Human   194 GKSFSNTSHLIIHERTHTG---------------EKPYKCPECGKRFSSSSHLIQHHRSHTGEKP 243

  Fly   388 HECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKT 452
            :||.:||..|:.:..|..|..||||.:||||..|..:|:..|:..:|.|.||.|:||:|..|.|:
Human   244 YECSVCGKGFSHSYVLIEHQRTHTGEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPYKCLECEKS 308

  Fly   453 FTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARES 504
            |...:||..|:.|||||||:.|..|||.|.::..|..|:.:|  .|:.:.||
Human   309 FGCNSTLIKHQRIHTGEKPYQCPECGKNFSRSSNLITHQKMH--TGEKSYES 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
ZNF572NP_689625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 9/62 (15%)
COG5048 122..494 CDD:227381 79/254 (31%)
C2H2 Zn finger 134..154 CDD:275368 2/19 (11%)
C2H2 Zn finger 162..182 CDD:275368 2/19 (11%)
C2H2 Zn finger 190..210 CDD:275368 3/19 (16%)
C2H2 Zn finger 218..238 CDD:275368 7/19 (37%)
C2H2 Zn finger 246..266 CDD:275368 6/19 (32%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
C2H2 Zn finger 386..406 CDD:275368
C2H2 Zn finger 414..434 CDD:275368
C2H2 Zn finger 442..462 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.