DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Mzf1

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_006539528.1 Gene:Mzf1 / 109889 MGIID:107457 Length:814 Species:Mus musculus


Alignment Length:144 Identity:61/144 - (42%)
Similarity:80/144 - (55%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 EFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYC 421
            |..:.|..||..:..:..||:|::||:|.||..|..||..|:|..:|.||..||||.:||.|..|
Mouse   646 ERPFACAECGKTFRQRPTLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYCCGEC 710

  Fly   422 PAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQ--- 483
            ...|..:|...:|.||||.|||:.|..|.::|.....|..|:.|||||:|:.|..|||.|.|   
Mouse   711 GLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPT 775

  Fly   484 -AYKLRNHRVIHER 496
             ...||.||  ||:
Mouse   776 LTQHLRTHR--HEK 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 28/60 (47%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 10/23 (43%)
Mzf1XP_006539528.1 SCAN 121..232 CDD:128708
COG5048 416..807 CDD:227381 61/144 (42%)
C2H2 Zn finger 438..458 CDD:275368
C2H2 Zn finger 466..486 CDD:275368
C2H2 Zn finger 494..514 CDD:275368
C2H2 Zn finger 522..542 CDD:275370
C2H2 Zn finger 567..587 CDD:275368
C2H2 Zn finger 595..615 CDD:275368
C2H2 Zn finger 623..643 CDD:275368
C2H2 Zn finger 651..671 CDD:275368 6/19 (32%)
C2H2 Zn finger 679..699 CDD:275368 8/19 (42%)
C2H2 Zn finger 707..727 CDD:275368 6/19 (32%)
C2H2 Zn finger 735..755 CDD:275368 5/19 (26%)
C2H2 Zn finger 763..783 CDD:275368 8/19 (42%)
C2H2 Zn finger 791..811 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.