Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008758162.1 | Gene: | LOC103691238 / 103691238 | RGDID: | 9074604 | Length: | 337 | Species: | Rattus norvegicus |
Alignment Length: | 253 | Identity: | 76/253 - (30%) |
---|---|---|---|
Similarity: | 115/253 - (45%) | Gaps: | 37/253 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 ASIHARNATKRRVNPR--------RSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMS- 322
Fly 323 ----------------IKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPS 371
Fly 372 QSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHR 436
Fly 437 IHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
C2H2 Zn finger | 362..382 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 375..399 | CDD:290200 | 12/23 (52%) | ||
COG5048 | 386..>447 | CDD:227381 | 25/60 (42%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 432..455 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 459..481 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 6/19 (32%) | ||
LOC103691238 | XP_008758162.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 3/19 (16%) |
COG5048 | <111..270 | CDD:227381 | 59/170 (35%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 5/28 (18%) | ||
C2H2 Zn finger | 146..166 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 254..>314 | CDD:227381 | 9/25 (36%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | |||
C2H2 Zn finger | 314..334 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 139 | 1.000 | Inparanoid score | I4420 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |