| Sequence 1: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_932128.2 | Gene: | E430018J23Rik / 101604 | MGIID: | 2141981 | Length: | 461 | Species: | Mus musculus |
| Alignment Length: | 281 | Identity: | 81/281 - (28%) |
|---|---|---|---|
| Similarity: | 120/281 - (42%) | Gaps: | 55/281 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 245 EDDAEVDLNSTEEEFVPSKSVRASIHAR-NATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLK 308
Fly 309 VRRG-NSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQ 372
Fly 373 SRLTEHIKVHSGVK----------------------------PHECEICGHCFAQAQQLARHMNT 409
Fly 410 HTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVC 474
Fly 475 DVCGKGFPQAYKLRNH-RVIH 494 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
| C2H2 Zn finger | 362..382 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 375..399 | CDD:290200 | 12/51 (24%) | ||
| COG5048 | 386..>447 | CDD:227381 | 26/88 (30%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 432..455 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 459..481 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 474..494 | CDD:275368 | 10/20 (50%) | ||
| E430018J23Rik | NP_932128.2 | KRAB | 22..81 | CDD:214630 | 2/5 (40%) |
| KRAB | 22..61 | CDD:279668 | |||
| C2H2 Zn finger | 170..190 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 183..207 | CDD:290200 | 6/23 (26%) | ||
| C2H2 Zn finger | 198..218 | CDD:275368 | 0/19 (0%) | ||
| zf-H2C2_2 | 210..235 | CDD:290200 | 6/24 (25%) | ||
| COG5048 | <223..383 | CDD:227381 | 48/109 (44%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 239..259 | CDD:290200 | 10/19 (53%) | ||
| C2H2 Zn finger | 254..302 | CDD:275368 | 16/47 (34%) | ||
| zf-H2C2_2 | 298..319 | CDD:290200 | 11/20 (55%) | ||
| C2H2 Zn finger | 310..331 | CDD:275368 | 10/20 (50%) | ||
| C2H2 Zn finger | 339..359 | CDD:275368 | |||
| zf-H2C2_2 | 351..376 | CDD:290200 | |||
| C2H2 Zn finger | 367..387 | CDD:275368 | |||
| zf-H2C2_2 | 383..402 | CDD:290200 | |||
| C2H2 Zn finger | 395..415 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 151 | 1.000 | Inparanoid score | I4340 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||