DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp984

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001120661.1 Gene:Zfp984 / 100041677 MGIID:3651978 Length:547 Species:Mus musculus


Alignment Length:342 Identity:92/342 - (26%)
Similarity:146/342 - (42%) Gaps:60/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKS 264
            |.|...|..:....|....:.|.|.|..|.:    ||..:.|.:.:.|..:.:.....:..|.|:
Mouse    44 ENYNNLLFVENHCIHGKYGKVLGEESQYIVH----EHVNIQEKSSKWDKLIKVILESPQCTPYKT 104

  Fly   265 VRASIHARNATKRRVNPRRSA------TSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSI 323
            ..:|:...|  ::|:.||.:.      .|..||::.|:.|  .::|..|:.::.|.::...|:.:
Mouse   105 NHSSLQYSN--QKRLKPRNTKEVCKYNDSVNSVSLFSTIS--LNQGIHLQKKKHNRNAEFEKVFV 165

  Fly   324 KSEKDISIGEVLARKHSGI----------------KTKGGHKILLGDK----------------- 355
            ...|     .::.|.::|:                |.:...:|..|.|                 
Mouse   166 SKHK-----VMVKRNNTGVNPYKCSEFDKYLTQREKLQSQQRIYHGKKPYRSSKSDKCFTHQIHL 225

  Fly   356 --------KEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTG 412
                    :|..|.|..|...:..:|.|..|.::|:|..|::|..|..||......:.|...|||
Mouse   226 SIHQGIHAEEKIYKCSECDKCFTHKSHLNIHQRIHTGENPYKCSECDKCFKHKFSFSMHQRIHTG 290

  Fly   413 NRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVC 477
            .:|||||.|...|...|..:.|.||||.|:||:|..|.|.||:.:.|..|:.|||||||:.|..|
Mouse   291 EKPYKCSECDKCFTQKSHLSVHQRIHTGEKPYKCSECDKCFTHKSHLNSHQRIHTGEKPYKCSEC 355

  Fly   478 GKGFPQAYKLRNHRVIH 494
            .|.|.:...||.|:.||
Mouse   356 DKCFTKNGSLRIHQRIH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 25/60 (42%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zfp984NP_001120661.1 KRAB 12..52 CDD:396083 3/7 (43%)
C2H2 Zn finger 184..204 CDD:275368 1/19 (5%)
C2H2 Zn finger 216..232 CDD:275368 0/15 (0%)
COG5048 <220..465 CDD:227381 57/153 (37%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
C2H2 Zn finger 380..400 CDD:275368
C2H2 Zn finger 408..428 CDD:275368
C2H2 Zn finger 436..456 CDD:275368
C2H2 Zn finger 464..484 CDD:275368
zf-H2C2_2 476..500 CDD:404364
C2H2 Zn finger 492..512 CDD:275368
zf-H2C2_2 504..529 CDD:404364
C2H2 Zn finger 520..540 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.