DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and TT1

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:229 Identity:51/229 - (22%)
Similarity:77/229 - (33%) Gaps:65/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 EEPPEEEIAEDILDSDEDYD-----PTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKPRNK 268
            ||..:||..|:..|.:.|.|     |...||....:..:|     :|..::.|:  ..|:...|:
plant    67 EEGEQEEEEEEEEDREVDVDLHIGLPGFGKPSNDAKQLKK-----RNGKEIATY--DAGKGIENE 124

  Fly   269 LS-----------------TYICDVCGNIYPTQARLTEHMKFH-----------SGVKPH----- 300
            ||                 .:.|.||...:.....|..||..|           .|.:|.     
plant   125 LSGKAYWIPAPEQILIGFTHFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGI 189

  Fly   301 ECEICGRGFVQN------------QQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
            .|..|..|...:            :.|..|.....|::|:.|..|....|.:.    ..|.|.|.
plant   190 PCYCCVEGCRNHIDHPRSKPLKDFRTLQTHYKRKHGHKPFSCRLCGKLLAVKG----DWRTHEKN 250

  Fly   354 --RPYVCDVCSRTFTYSDNLKFH-KMIHTGEKPH 384
              :.:|| ||...|.:..:||.| |...:|..|:
plant   251 CGKRWVC-VCGSDFKHKRSLKDHVKAFGSGHGPY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 36/169 (21%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/39 (23%)
C2H2 Zn finger 302..322 CDD:275368 5/31 (16%)
zf-H2C2_2 315..338 CDD:290200 6/22 (27%)
C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
zf-H2C2_2 345..367 CDD:290200 8/23 (35%)
C2H2 Zn finger 358..378 CDD:275368 8/20 (40%)
zf-H2C2_2 370..394 CDD:290200 6/16 (38%)
C2H2 Zn finger 386..406 CDD:275368
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/19 (21%)
C2H2 Zn finger 257..274 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.