DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZNF239

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_011538534.1 Gene:ZNF239 / 8187 HGNCID:13031 Length:602 Species:Homo sapiens


Alignment Length:343 Identity:107/343 - (31%)
Similarity:159/343 - (46%) Gaps:34/343 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMKVEGEE 137
            ||.....:.||....:...|.|......:|:  |.:|:|.|: ::...::.||.|     :.||.
Human   224 KFCKNEPQDHQESRRLFVMEESTERKVIKGE--SCSENLQVK-LVSDGQELASPL-----LNGEA 280

  Fly   138 DQQHQVITYVVEDGDTDDTNMFDVHD-PTQPVPNEIEEAETYAEYEEYELLTNENSPEI--AQEK 199
            ..|:..:.   |..|..|.|..|:|. .:|.|....:.|.|     |.:...:.|..:|  ....
Human   281 TCQNGQLK---ESLDPIDCNCKDIHGWKSQVVSCSQQRAHT-----EEKPCDHNNCGKILNTSPD 337

  Fly   200 GSTGTDVATEEPPEE--EIAEDILDSDE----DYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFK 258
            |.....:.|.|...|  :..::...|.|    ..|.|..||.||::.|:   .:.::|..:....
Human   338 GHPYEKIHTAEKQYECSQCGKNFSQSSELLLHQRDHTEEKPYKCEQCGK---GFTRSSSLLIHQA 399

  Fly   259 KKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHT 323
            .....||      |.||.||..:...:.|..|...|:|.||::|:.||:||.|:.:|..|...||
Human   400 VHTDEKP------YKCDKCGKGFTRSSSLLIHHAVHTGEKPYKCDKCGKGFSQSSKLHIHQRVHT 458

  Fly   324 GNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDL 388
            |.:||:|..|..:|:.||....|.|:||.||||.|..|.:.|:.|.||..|:.|||||||:.|..
Human   459 GEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKGFSQSSNLHIHRCIHTGEKPYQCYE 523

  Fly   389 CGKGFVKAYKLRLHRETH 406
            |||||.::..||:|...|
Human   524 CGKGFSQSSDLRIHLRVH 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 4/13 (31%)
COG5048 <264..411 CDD:227381 63/143 (44%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 9/22 (41%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 15/23 (65%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
ZNF239XP_011538534.1 C2H2 Zn finger 326..345 CDD:275368 3/18 (17%)
COG5048 <337..537 CDD:227381 75/208 (36%)
C2H2 Zn finger 353..373 CDD:275368 2/19 (11%)
zf-H2C2_2 365..390 CDD:290200 8/27 (30%)
C2H2 Zn finger 381..401 CDD:275368 3/22 (14%)
zf-H2C2_2 393..418 CDD:290200 7/30 (23%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 421..446 CDD:290200 11/24 (46%)
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
zf-H2C2_2 453..474 CDD:290200 9/20 (45%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
zf-H2C2_2 481..502 CDD:290200 11/20 (55%)
C2H2 Zn finger 493..513 CDD:275368 7/19 (37%)
zf-C2H2 519..541 CDD:278523 9/21 (43%)
C2H2 Zn finger 521..541 CDD:275368 9/19 (47%)
zf-H2C2_2 533..558 CDD:290200 4/9 (44%)
COG5048 545..>602 CDD:227381
C2H2 Zn finger 549..569 CDD:275368
zf-H2C2_2 562..586 CDD:290200
C2H2 Zn finger 577..597 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.