DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment trem and OVOL3

DIOPT Version :9

Sequence 1:	NP_650861.1	Gene:	trem / 42392	FlyBaseID:	FBgn0038767	Length:	439	Species:	Drosophila melanogaster
Sequence 2:	XP_016882679.1	Gene:	OVOL3 / 728361	HGNCID:	14186	Length:	213	Species:	Homo sapiens

Alignment Length:	125	Identity:	45/125 - (36%)
Similarity:	63/125 - (50%)	Gaps:	12/125 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   265 PRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYK 329
            ||.. .|..|.:|...:|.|..||.|:|.||.|:.|.|..||:||.....|.|||.||||.||::
Human    87 PRGP-GTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFR 150

  Fly   330 CNYCPAAFADRSTKTKH-HRIH----------TKERPYVCDVCSRTFTYSDNLKFHKMIH 378
            |:.|..||..|.:...| .::|          .:|:.:||:.|..|.:..|....|:.:|
Human   151 CSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRALH 210

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
trem	NP_650861.1	zf-AD	11..87	CDD:214871
		COG5048	<264..411	CDD:227381	45/125 (36%)
		C2H2 Zn finger	274..294	CDD:275368	8/19 (42%)
		zf-H2C2_2	287..311	CDD:290200	13/23 (57%)
		C2H2 Zn finger	302..322	CDD:275368	9/19 (47%)
		zf-H2C2_2	315..338	CDD:290200	13/22 (59%)
		C2H2 Zn finger	330..350	CDD:275368	6/20 (30%)
		zf-H2C2_2	345..367	CDD:290200	7/32 (22%)
		C2H2 Zn finger	358..378	CDD:275368	5/19 (26%)
		zf-H2C2_2	370..394	CDD:290200	2/9 (22%)
		C2H2 Zn finger	386..406	CDD:275368
OVOL3	XP_016882679.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910