Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074900.1 | Gene: | Zscan25 / 666311 | MGIID: | 3647079 | Length: | 543 | Species: | Mus musculus |
Alignment Length: | 233 | Identity: | 71/233 - (30%) |
---|---|---|---|
Similarity: | 114/233 - (48%) | Gaps: | 25/233 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 197 QEKGSTGTDVATEEPPEEEI-AEDILDSDEDYDPTHAKPEKCDRSGR-----KPVAYHKNSPKVE 255
Fly 256 ------------TFKKKVGRKPRNKLS--TYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICG 306
Fly 307 RGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNL 371
Fly 372 KFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRR 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
COG5048 | <264..411 | CDD:227381 | 55/148 (37%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 6/19 (32%) | ||
Zscan25 | NP_001074900.1 | SCAN | 38..120 | CDD:396558 | |
KRAB_A-box | 230..>258 | CDD:413388 | |||
COG5048 | <338..531 | CDD:227381 | 59/197 (30%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 376..396 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 404..424 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 432..452 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 460..479 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 487..507 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 515..534 | CDD:275368 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 151 | 1.000 | Inparanoid score | I4340 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |