DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZSCAN31

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001128687.1 Gene:ZSCAN31 / 64288 HGNCID:14097 Length:406 Species:Homo sapiens


Alignment Length:378 Identity:95/378 - (25%)
Similarity:161/378 - (42%) Gaps:72/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RCLRLCYKFRLTCQRSHQHIMDMLDRE--------------ASNANAAGEGDLLSIAEDLSVESV 116
            |...||:::......:.:.|:::|..|              ..:...:|| :.:::.|||..|  
Human    59 RLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGE-EAVAVVEDLEQE-- 120

  Fly   117 LKSWEDYASQLDGGMKVEGEE--DQQHQVITYVVEDGDTDDTNMFDVHDPT----QPVPNEI--- 172
                          :...|.:  |.:|.....::||.:    ::....:||    ||:..::   
Human   121 --------------LSEPGNQAPDHEHGHSEVLLEDVE----HLKVKQEPTDIQLQPMVTQLRYE 167

  Fly   173 ---------EEAETYAEYEEYELLTNENSPEIAQEKGSTG-----TDVATEEPPEEEIAEDILDS 223
                     ::.|:..|.:|.     .:..||.:|....|     .||:.:....|....|....
Human   168 SFCLHQFQEQDGESIPENQEL-----ASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAE 227

  Fly   224 DEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLT 288
            .:....|..:..:|:..|:   ::.|:|..:|..:...|.||      |.|:.||..:..::.|.
Human   228 KQQAHSTGERRHRCNECGK---SFTKSSVLIEHQRIHTGEKP------YECEECGKAFSRRSSLN 283

  Fly   289 EHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
            ||.:.|:|.||::|:.||:.|..:..|.||...|||.:||:|..|..||...|...:|.||||.|
Human   284 EHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGE 348

  Fly   354 RPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETH 406
            :.|.|..|.:.|..:..|..|..:||||||:.|..|.|.|.|...|:.|::.|
Human   349 KRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 4/20 (20%)
COG5048 <264..411 CDD:227381 56/143 (39%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 11/23 (48%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZSCAN31NP_001128687.1 SCAN 35..146 CDD:128708 17/107 (16%)
SCAN 35..123 CDD:280241 12/80 (15%)
COG5048 <156..397 CDD:227381 74/254 (29%)
zf-C2H2 239..261 CDD:278523 5/24 (21%)
C2H2 Zn finger 241..261 CDD:275368 5/22 (23%)
zf-H2C2_2 254..278 CDD:290200 8/29 (28%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 281..305 CDD:290200 10/23 (43%)
C2H2 Zn finger 297..317 CDD:275368 7/19 (37%)
zf-H2C2_2 310..332 CDD:290200 10/21 (48%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
zf-H2C2_2 338..362 CDD:290200 10/23 (43%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.