DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG18764

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:439 Identity:106/439 - (24%)
Similarity:173/439 - (39%) Gaps:102/439 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRVC---LNNPS-------EGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVR 66
            ||.|   :.|..       |.|::|.||...|.:|     ||        .|...|..:|:.|..
  Fly     5 CRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTT-----LH--------NDPELPSSICACCTL 56

  Fly    67 CLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEG--------DLLS---------IAE----- 109
            .|.....||..|..:.:.::..  |.:..|....|.        |.|:         |.|     
  Fly    57 DLNQAILFRERCILTQKQLVHR--RRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEV 119

  Fly   110 ---------DLSVESVLKSWEDYASQLDGGMKVEGEEDQQ--HQVITYVVEDGDT---DDTNMFD 160
                     ||..::.:.|.||..:..|  |....|||.|  ..:|:.|.::.::   ||:|. |
  Fly   120 LDHDSDAHHDLDEDNYIDSVEDVDALQD--MAEVAEEDSQDVESLISSVQKELESICNDDSNS-D 181

  Fly   161 VHDPTQPVPNEIEEAETYAE-YEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDILDSD 224
            .:|..:|     :....:.| ..|||:.:|.|:| :.:.|.:.|...                  
  Fly   182 NNDYMEP-----QNGSYFNETINEYEVSSNPNTP-LPESKSAAGRST------------------ 222

  Fly   225 EDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTE 289
               .|...||::     :|.....||..:.:..::|..::.|.    .:|:.||..:..|:....
  Fly   223 ---KPATTKPKR-----KKQYVTWKNMTEEQIIERKRLQRKRE----CVCEQCGRQFTDQSNFKL 275

  Fly   290 HMKFHSGVKPHECEICGRGFVQNQQLVRHMN-THTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
            ||..|:|.|...|:.||:.|..:..:..|.. .|.|.:||.|.:|..:|.:.:|:..|.|.||..
  Fly   276 HMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNA 340

  Fly   354 RPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLH 402
            :||.|..|.:.|..:...|.|::||||.:...|.:|.:.|.:...|:.|
  Fly   341 KPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 21/84 (25%)
COG5048 <264..411 CDD:227381 43/140 (31%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 5/20 (25%)
zf-H2C2_2 315..338 CDD:290200 7/23 (30%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 9/21 (43%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 5/17 (29%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 21/82 (26%)
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 9/24 (38%)
C2H2 Zn finger 288..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.