| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067043.2 | Gene: | OVOL2 / 58495 | HGNCID: | 15804 | Length: | 275 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 71/233 - (30%) |
|---|---|---|---|
| Similarity: | 98/233 - (42%) | Gaps: | 35/233 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 168 VPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTHA 232
Fly 233 KPEKCDRSG--------RKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTE 289
Fly 290 HMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKH-HRIH--- 350
Fly 351 -------TKERPYVCDVCSRTFTYSDNLKFH-KMIHTG 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 46/129 (36%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 15/22 (68%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 8/32 (25%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 4/12 (33%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | |||
| OVOL2 | NP_067043.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 15..101 | 19/84 (23%) | |
| C2H2 Zn finger | 121..141 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 161..186 | CDD:316026 | 16/24 (67%) | ||
| C2H2 Zn finger | 177..198 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 216..233 | CDD:275368 | 4/16 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||