DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and Zscan26

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001334420.1 Gene:Zscan26 / 432731 MGIID:3531417 Length:466 Species:Mus musculus


Alignment Length:431 Identity:99/431 - (22%)
Similarity:161/431 - (37%) Gaps:118/431 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RCLRLCYKFRLTCQRSHQHIMDMLDRE--------------ASNANAAGEGDLLSIAEDLSVESV 116
            |...||.::......|.:.|:::|..|              ..:....|| :|:.|.|||     
Mouse    62 RLRELCRQWLRPETHSKEQILELLVLEQFLTILPRDLQVQVLEHHPETGE-ELVGILEDL----- 120

  Fly   117 LKSWEDYASQLDGGMKVEGEEDQQHQVITYVV------------------------------EDG 151
                     |||.|...|.::..|....|.:|                              |:|
Mouse   121 ---------QLDRGKAGEQKDSAQRSRPTVLVGEPAPRREAREQPGCALPQKPEERGKETRSENG 176

  Fly   152 D----TDDTNMFDVH-DPTQPVPNEIEE-----------AETYAEYEEYELLTNENSPEIAQEKG 200
            :    ||.....:.. ..|:|:..:.|:           .:|.::..|.:....:||..|..::.
Mouse   177 NLIAGTDSCGRMESSCTMTEPIEAQCEDLSLKKNPAMPKEKTNSQCLETKERLVQNSGLIEHDRA 241

  Fly   201 STGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKP 265
            .||.........:..:|.|..:..:|      |...|...|:   .:.::|..:...|..:|.||
Mouse   242 HTGEMSWESVGSQSSVAADHQEISKD------KGHPCQECGK---VFQRSSHLIRHQKIHLGEKP 297

  Fly   266 RNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRP--- 327
                  |.|..||.::...|.|.||::.|:|.||:.|..||:.|.::..|.||...|:.:.|   
Mouse   298 ------YQCKECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQKIHSQDEPREC 356

  Fly   328 -------------------------YKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTY 367
                                     :.||.|..||:..|...:||||||.|:|:.|:||.:.|..
Mouse   357 KECGKTFSRALLLTHHQRVHGRSKRHHCNECGKAFSLTSDLIRHHRIHTGEKPFKCNVCQKAFRL 421

  Fly   368 SDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNR 408
            :.:|..|..||..|||:.|..|.:.|.:...|..|:..|::
Mouse   422 NSHLDQHVRIHNEEKPYKCSECNEAFRQKSGLFQHQRHHHK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 5/20 (25%)
COG5048 <264..411 CDD:227381 54/173 (31%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 9/50 (18%)
C2H2 Zn finger 330..350 CDD:275368 9/19 (47%)
zf-H2C2_2 345..367 CDD:290200 12/21 (57%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 9/23 (39%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
Zscan26NP_001334420.1 SCAN 43..151 CDD:413396 22/103 (21%)
COG5048 <253..463 CDD:227381 63/225 (28%)
C2H2 Zn finger 272..292 CDD:275368 4/22 (18%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
C2H2 Zn finger 328..348 CDD:275368 7/19 (37%)
C2H2 Zn finger 356..376 CDD:275368 0/19 (0%)
C2H2 Zn finger 384..404 CDD:275368 9/19 (47%)
C2H2 Zn finger 412..432 CDD:275368 6/19 (32%)
C2H2 Zn finger 440..460 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.