| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650879.1 | Gene: | CG4360 / 42413 | FlyBaseID: | FBgn0038787 | Length: | 556 | Species: | Drosophila melanogaster |
| Alignment Length: | 313 | Identity: | 75/313 - (23%) |
|---|---|---|---|
| Similarity: | 118/313 - (37%) | Gaps: | 76/313 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 159 FDVHDPT--QPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDIL 221
Fly 222 DSDEDY---DPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPT 283
Fly 284 QARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTH-----------------TGN------ 325
Fly 326 ---------------------------------RPYKCNYCPAAFADRSTKTKHHRIHTKERPYV 357
Fly 358 CDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRI 410 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 53/203 (26%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 9/78 (12%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 5/19 (26%) | ||
| CG4360 | NP_650879.1 | C2H2 Zn finger | 144..164 | CDD:275368 | 2/19 (11%) |
| zf-H2C2_2 | 157..181 | CDD:290200 | 6/34 (18%) | ||
| C2H2 Zn finger | 172..192 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 185..209 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 200..220 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 284..304 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2_8 | 287..363 | CDD:292531 | 28/75 (37%) | ||
| C2H2 Zn finger | 312..332 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 340..360 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 478..498 | CDD:275368 | |||
| zf-H2C2_2 | 491..515 | CDD:290200 | |||
| C2H2 Zn finger | 506..526 | CDD:275368 | |||
| zf-H2C2_2 | 519..543 | CDD:290200 | |||
| C2H2 Zn finger | 534..554 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471453 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||