DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG4424

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:423 Identity:124/423 - (29%)
Similarity:179/423 - (42%) Gaps:124/423 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRVCLNNPSEGEELLHDIFSETASTRLDQMLHIC------AGIPV---SLDDNFPDKMCSKCVR 66
            :||.||   .:||..:..|| :||..||...:.:|      :||.:   :.::..|.::|.:|..
  Fly    10 LCRTCL---QDGEAHMVSIF-QTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKA 70

  Fly    67 CLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGM 131
            .|.|.:|||..||||::.:.:                                            
  Fly    71 FLTLAHKFRQICQRSNEFLRE-------------------------------------------- 91

  Fly   132 KVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIA 196
                          ||::|.            ..|.|..|:                      :.
  Fly    92 --------------YVIKDA------------VEQGVVKEV----------------------VQ 108

  Fly   197 QEKGSTGTDVATE--EPPEEEIAEDILDSDED--YDPTHAKPEKCDRS-----GRKPVAYHKNSP 252
            |.:.||...:.||  ||||:|:.|:.:.|.||  .:..|...|| :|.     ...|..|   .|
  Fly   109 QTRPSTPPPIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAEK-ERPTVLTVEMLPAPY---PP 169

  Fly   253 KVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVR 317
            ...|.........:.||  ::|.:|||.||.::.|..||:.|:..:|:|||||.:.|..|.||.|
  Fly   170 PASTPPPAPAGAVKGKL--HVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKR 232

  Fly   318 HMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEK 382
            |:..|||.:||.|.||...||||::..||.|.|..||||.|..|.:.|||:..||.|...|||||
  Fly   233 HIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEK 297

  Fly   383 PHVCDLCGKGFVKAYKLRLHRET----HNRRIT 411
            ||:|.||.|.|.:.:.|..|.:|    ::.|:|
  Fly   298 PHICQLCNKSFARIHNLVAHLQTQQHINDPRLT 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 27/84 (32%)
COG5048 <264..411 CDD:227381 68/150 (45%)
C2H2 Zn finger 274..294 CDD:275368 9/19 (47%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 10/19 (53%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 10/19 (53%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 14/23 (61%)
C2H2 Zn finger 386..406 CDD:275368 8/23 (35%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 27/143 (19%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
DUF45 <204..281 CDD:302795 37/76 (49%)
COG5048 210..>345 CDD:227381 57/121 (47%)
C2H2 Zn finger 217..237 CDD:275368 10/19 (53%)
C2H2 Zn finger 245..265 CDD:275368 10/19 (53%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 15/23 (65%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.