DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and gl

DIOPT Version :10

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster


Alignment Length:208 Identity:66/208 - (31%)
Similarity:96/208 - (46%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 DEDYDPTHAKPEKCDRS--GRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQAR 286
            ::.|.|.|..|.....:  |....|:.......|......| ....::...:|.:||..|...:.
  Fly   388 NQGYTPPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEG-SSGGEMKPNLCRLCGKTYARPST 451

  Fly   287 LTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHT 351
            |..|::.|||.:|:.|..|.:.|.|...|..|:.||||.:|::|..|...|:..|:.|.|.|.|:
  Fly   452 LKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHS 516

  Fly   352 KERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDA 416
            .||||.|..|.::|:.|..|..|..||:||||:.|.||...|.::..|..|...|..    .|.:
  Fly   517 GERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGN----NNSS 577

  Fly   417 EESTKAEDVKGET 429
            ..|..|..|.||:
  Fly   578 NGSNGATGVGGES 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 52/146 (36%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
glNP_001262708.1 COG5048 <426..571 CDD:227381 52/145 (36%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..487 CDD:275368 6/19 (32%)
C2H2 Zn finger 495..515 CDD:275368 7/19 (37%)
C2H2 Zn finger 523..543 CDD:275368 6/19 (32%)
C2H2 Zn finger 551..571 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.