DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG17803

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:521 Identity:111/521 - (21%)
Similarity:187/521 - (35%) Gaps:143/521 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLD-DNFPDKMCSKCVRCLRLCYKFR 75
            ||.|....|..|: ..|:: :..:..|...:.:..|:.:... ...|..:||.|...:....:||
  Fly    86 CRTCFRIISRHED-AQDLY-DRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNKSMEFR 148

  Fly    76 LTCQR--------SHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMK 132
            ..||:        :.::.:.:.|.|..:                .:|:||  :|:.|.|..|   
  Fly   149 AKCQQVDKKLRQTTEKYNIQICDEEMES----------------ELENVL--YEESAQQAKG--- 192

  Fly   133 VEGEEDQQHQVITYVVEDGDTDDTNMFDVHD-PTQPVPNEIEEAETYAEYEEYELLTNENSPEIA 196
            |.|.||...:::        .|...:.|..| |....|.:...:|     :|.: |..:...:.|
  Fly   193 VVGLEDFSSELL--------PDSEGVLDEDDFPLDAEPTQFSLSE-----DELD-LDRDTEKDFA 243

  Fly   197 QEKGSTGTDVAT--EEPPEEEIAEDILDSDE--------DYDPTHAKPEKCDRS-GRKPVAYHKN 250
            .|:..:..::.:  :...:|||.:  :|...        :|:.......|...| .:||......
  Fly   244 LEQNKSCNEIISIRKCKTKEEIGK--VDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSP 306

  Fly   251 SPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHM----------------KF------ 293
            ..|....::::..||.|    |:||.||:.:..:::|..|:                ||      
  Fly   307 EEKNRRRRERIQAKPLN----YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTR 367

  Fly   294 -------HSGVKP-------------------------------------------HECEICGRG 308
                   |.|..|                                           |.|..|.:.
  Fly   368 NIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKS 432

  Fly   309 FVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKF 373
            :...:.||.|||.|.|:||::|..|...|||.|...:|..:|.| .|..||:|.:.|.....|..
  Fly   433 YTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDK-FPIRCDICLKGFLLRSQLTK 496

  Fly   374 HKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAEDVKGETPEFLNELPK 438
            |:.:|||..||.|::|...:...|.|..|:.|...|     |..:....|:|.|....| .::.|
  Fly   497 HQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHR-----DNMQKAIKEEVNGLQQAF-KDIDK 555

  Fly   439 E 439
            |
  Fly   556 E 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 16/83 (19%)
COG5048 <264..411 CDD:227381 55/218 (25%)
C2H2 Zn finger 274..294 CDD:275368 8/48 (17%)
zf-H2C2_2 287..311 CDD:290200 10/95 (11%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 8/21 (38%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 9/23 (39%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 16/75 (21%)
COG5048 <323..528 CDD:227381 51/209 (24%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 2/20 (10%)
C2H2 Zn finger 383..401 CDD:275368 0/17 (0%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.