DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG6813

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:402 Identity:96/402 - (23%)
Similarity:141/402 - (35%) Gaps:128/402 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCLRLCYKFRL 76
            ||:|..:.:.     .|:|. ..:..|.:.:|...|:.:|.......:||:.|:..|:...|||.
  Fly     6 CRICSRSDAP-----IDLFG-PGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQ 64

  Fly    77 TCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMKVEGEEDQQH 141
            .|                           .|||..::|.:                   |.|.  
  Fly    65 RC---------------------------IIAEKQNLERI-------------------ECDS-- 81

  Fly   142 QVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTGTDV 206
                   :|..||.....|:.|      |:||     :|.:|..|     .||:..         
  Fly    82 -------KDCSTDPIIYEDIDD------NQIE-----SELDESIL-----CPEVKD--------- 114

  Fly   207 ATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLST 271
             ...|..|:::.          ||....:|....|..|                           
  Fly   115 -LPMPSAEKVSA----------PTSLNHQKSIGGGTGP--------------------------- 141

  Fly   272 YICDVCGNIYPTQARLTEHMKFHSGVKPHECEI--CGRGFVQNQQLVRHMNTHTGNRPYKCNYCP 334
            |:|..||.|...::...||...|:|:|...|..  |.|.|...::|..|...|||.:||.|.|||
  Fly   142 YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCP 206

  Fly   335 AAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKL 399
            ..|:....:.:|||.|..||.|.||.|.::|..|..|:.|||||...:.|.|.:|.|.|.:...|
  Fly   207 RRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHL 271

  Fly   400 RLHRET--HNRR 409
            ..|..:  |.|:
  Fly   272 MTHLSSNIHKRK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 17/74 (23%)
COG5048 <264..411 CDD:227381 53/150 (35%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/25 (36%)
C2H2 Zn finger 302..322 CDD:275368 6/21 (29%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 8/19 (42%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 9/19 (47%)
zf-H2C2_2 370..394 CDD:290200 10/23 (43%)
C2H2 Zn finger 386..406 CDD:275368 6/21 (29%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 20/102 (20%)
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 9/28 (32%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.