DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG14711

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:460 Identity:130/460 - (28%)
Similarity:197/460 - (42%) Gaps:135/460 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KWVVCRVCL--------------NNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPD 58
            ::::||:||              :|.::..||:..| .|..|.:|         :|:   .|.|.
  Fly     3 EYMLCRICLTEDINSEAMAPLFDDNDAQCRELVRKI-EEVGSIKL---------VPL---QNIPS 54

  Fly    59 KMCSKCVRCLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDY 123
            .:|..||..|...:|||..||.|.:..       |:|                    |:|:    
  Fly    55 MLCYSCVERLTSAHKFRELCQESERTF-------ATN--------------------VVKA---- 88

  Fly   124 ASQLDGGMKVEGEEDQQHQV---ITYVVE------DGDTDDTNMFDVHDPTQPVPNEIEEAETYA 179
                  .||.|..::..|.|   |.|:.|      ||..||..|.::.:  :|:.:.:  .||..
  Fly    89 ------EMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMENIME--EPLEDGV--GETSQ 143

  Fly   180 EYEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDIL----DSDEDYDPTHAKPEKCDRS 240
            .||                   |.|.|       :::.||.|    .:|.||.|.    |:|.::
  Fly   144 AYE-------------------TSTVV-------DDLDEDDLLVPNSTDSDYQPI----ERCRKA 178

  Fly   241 ------------GR-------KPVAYHKNSPKVE-TFKKKVGRKPRNKLSTYICDVCGNIYPTQA 285
                        ||       .|.::.:..|.|: :||.    .|....:..:|::|||||..:|
  Fly   179 KVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKS----SPEVSSTNIMCEICGNIYSKRA 239

  Fly   286 RLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIH 350
            .|..||:.|...||.:||||.:.|....:|.||:..|||.:|:.|.||..:|||||:..:|.|.|
  Fly   240 ALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTH 304

  Fly   351 TKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRND 415
            |.|||:.|..|.:.|:||:.||.|.:.||||||.:|.:|.|.|.:.::|..|..|...:.|..:.
  Fly   305 TNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHH 369

  Fly   416 AEEST 420
            ..|.|
  Fly   370 KNERT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 24/89 (27%)
COG5048 <264..411 CDD:227381 62/146 (42%)
C2H2 Zn finger 274..294 CDD:275368 10/19 (53%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 10/19 (53%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 12/23 (52%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 24/87 (28%)
C2H2 Zn finger 228..248 CDD:275368 10/19 (53%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 50/112 (45%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 10/19 (53%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.