DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG6808

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:414 Identity:114/414 - (27%)
Similarity:181/414 - (43%) Gaps:57/414 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESNEKWVVCRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCL 68
            |.:.||.:||.|....:  :..|..:|...|    .::|...||..|..||..||::|:.|:..|
  Fly     2 EISIKWSMCRTCRKKGT--QSTLQSLFESNA----HKLLISYAGTSVKPDDGLPDQICTVCLMQL 60

  Fly    69 RLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMKV 133
            ....:|...|::|..|:..::.:..|:|:|         .|.|..:..|:..:....|...|..:
  Fly    61 EEVDRFLSACKQSDAHLRSLVRQTLSSASA---------FETLEDKDQLEQKKRARKQNISGRLI 116

  Fly   134 EGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTN-ENSPEIAQ 197
            |      ...|.:..::...:.|.           .:||.....::....::|..| ||..:|.|
  Fly   117 E------ENPINFKTQENALETTK-----------DDEILPINKFSSDFVFDLNVNAENEKDIHQ 164

  Fly   198 EKGSTGTDVATEEPPEEEIAEDILD---SDEDYDPTHAKPEKC--DRSGRKPVAYHKNSPKVE-T 256
            |              :..|::..||   ||::|..|:::....  |........||...|..: .
  Fly   165 E--------------DYTISDMDLDREISDQNYSETYSQESSAATDSIQETSEDYHNLEPSADYV 215

  Fly   257 FKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNT 321
            ....|..:|    ..|.|.:|.|.|...::|..|.:.|...|.|:||:|.:.|.....|..||.|
  Fly   216 IDLGVACEP----DKYRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRT 276

  Fly   322 HTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVC 386
            |||.:||:|.||...|||.||..||.|:||.||||.|::|.:||:.|.:...|..:|:.||.|.|
  Fly   277 HTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKC 341

  Fly   387 DLCGKGFVKAYKLRLHRETHNRRI 410
            .:|.|.|...::|..|.::...|:
  Fly   342 LMCKKEFRLKHQLTAHEKSLAHRL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 21/75 (28%)
COG5048 <264..411 CDD:227381 58/147 (39%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 12/22 (55%)
C2H2 Zn finger 330..350 CDD:275368 11/19 (58%)
zf-H2C2_2 345..367 CDD:290200 13/21 (62%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 21/75 (28%)
C2H2 Zn finger 229..249 CDD:275368 6/19 (32%)
zf-C2H2 255..277 CDD:278523 8/21 (38%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 12/23 (52%)
C2H2 Zn finger 285..305 CDD:275368 11/19 (58%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.