DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG6689

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:498 Identity:108/498 - (21%)
Similarity:171/498 - (34%) Gaps:164/498 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESNEKWVVCRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCL 68
            |..|:...||.|.|: ...:....|:|....|..|.. :.:.:|:.:|...:.|..||..|...|
  Fly   159 EKLEELQKCRTCYND-FTADFRAKDLFDPANSVLLFH-IEVISGVWISHKPDEPRLMCPACKSAL 221

  Fly    69 RLCYKFRLTCQRSHQHI------MDMLDREASNAN-AAGEGDLLSIAEDLSVESVLKSWEDYASQ 126
            .....||..|..:...:      .|.:..||.|.| .:.:.||:|..|:.:||.:    ||    
  Fly   222 DQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEI----ED---- 278

  Fly   127 LDGGMKVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEY------- 184
             .||..||.|.....|.....|:                       |.||:.|..:..       
  Fly   279 -AGGDHVEDEATSDDQTSQEAVD-----------------------EVAESPAAQDPLSVALGAK 319

  Fly   185 ---ELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVA 246
               |||......|.|:.:  .|..:|::...:|:.|.:            .||::          
  Fly   320 IFKELLDQYTGKEKARLR--KGAPIASKPKAKEKAAGE------------QKPKR---------- 360

  Fly   247 YHKNSPKVETFKKKVGR-----KPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICG 306
              ..:||.:..:..:.|     ||.|    ::||.||..:.....|..||..|:..|.::|..|.
  Fly   361 --SANPKTKEERNLIRRAQLRAKPPN----FVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECP 419

  Fly   307 RGF-----------------------------------------VQN------------------ 312
            :.|                                         |.|                  
  Fly   420 KTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKP 484

  Fly   313 QQLVR------------------HMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCD 359
            ::.||                  |:.:||....|||..|..:::| ..|.|.|.:..::||..||
  Fly   485 RESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSD-PNKLKRHEMTHEKRPLQCD 548

  Fly   360 VCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLH 402
            ||.:.|.....|:.|::|||||:|:.|::|...|...|.::.|
  Fly   549 VCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSH 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 18/81 (22%)
COG5048 <264..411 CDD:227381 50/216 (23%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 8/64 (13%)
C2H2 Zn finger 302..322 CDD:275368 8/96 (8%)
zf-H2C2_2 315..338 CDD:290200 9/40 (23%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 9/21 (43%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 10/23 (43%)
C2H2 Zn finger 386..406 CDD:275368 5/17 (29%)
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 18/74 (24%)
zf-C2H2 385..407 CDD:278523 7/21 (33%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 399..422 CDD:290200 7/22 (32%)
C2H2 Zn finger 415..436 CDD:275368 3/20 (15%)
C2H2 Zn finger 444..460 CDD:275368 0/15 (0%)
C2H2 Zn finger 492..512 CDD:275368 1/19 (5%)
C2H2 Zn finger 520..540 CDD:275368 6/20 (30%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 5/18 (28%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.