DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG8159

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:456 Identity:115/456 - (25%)
Similarity:186/456 - (40%) Gaps:116/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCLRLCYKFR 75
            |||||.::....:.|  .:|:..|...| |.:::..|:.:..:...||.||..|...|:....||
  Fly     5 VCRVCASSTDNSKSL--KLFNSGACKVL-QQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFR 66

  Fly    76 LTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDY-----ASQLDGGMKVEG 135
            ..|.||.:...:.|.|        .|.|....:...|..|..:..||.     ||.|:..:|:|.
  Fly    67 DRCLRSQKIFEESLVR--------NEEDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLES 123

  Fly   136 EEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKG 200
                        :.:||.:|              :.|:..::          .||...|:|.:..
  Fly   124 ------------LSNGDEED--------------DGIDHLDS----------CNEADMELAIKAM 152

  Fly   201 STGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKP 265
            |:.|:                      |.....|.:..|:.|:.:              |.|.|.
  Fly   153 SSSTE----------------------DDGTTSPVRLKRTRRRGL--------------KKGGKG 181

  Fly   266 RNK----LSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNR 326
            .|:    |..:.||.|||....::....|::.|||::|.:||:|...|:.:.:|..|...|||:|
  Fly   182 ENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDR 246

  Fly   327 PYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGK 391
            .::|.||...:.:.|.:.:|.|.||.:||::|..|.::||.|..||.|.:|||||:...|:||.:
  Fly   247 KFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHR 311

  Fly   392 GFVKAYKLRLHRETHNRRITWRNDAEE------------STKAEDVK--------GETPEFLNEL 436
            .|.:.    .|.:||.|..|.:::.|:            |..|:.||        .|...|..|:
  Fly   312 SFARP----THLKTHFRSNTHKHNLEKSMADAGGVQLSPSQSADQVKFVTEKEPEAEADAFTIEV 372

  Fly   437 P 437
            |
  Fly   373 P 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 22/75 (29%)
COG5048 <264..411 CDD:227381 54/150 (36%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 9/22 (41%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 9/21 (43%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 11/23 (48%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 22/75 (29%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
COG5048 <197..322 CDD:227381 46/128 (36%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)
zf-H2C2_2 265..287 CDD:290200 9/21 (43%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 12/23 (52%)
C2H2 Zn finger 306..328 CDD:275368 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.