DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and nom

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:434 Identity:103/434 - (23%)
Similarity:162/434 - (37%) Gaps:127/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRVC-----------LNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKC 64
            |||||           |..|...:.|              :.:.:..||.:....|.||.:|..|
  Fly     5 VCRVCGRSRLCPKAVELFKPGRQDIL--------------RRIQLITGILLQQIPNAPDMVCFCC 55

  Fly    65 VRCLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDG 129
            ...|:....||..|....:..:.:|           :.|.:..:|:..||.     .|.:::...
  Fly    56 QTDLQSAMIFRRQCILQQKKWVPLL-----------QSDKVGASEEKKVEP-----NDPSTKKKT 104

  Fly   130 GMKVEGEEDQQHQVITYVVED------GDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLT 188
            ..:..|......:::..||.:      |::...:.||     |||                    
  Fly   105 TKRRRGRPRMPLEIVDIVVTNESKASAGESVGGDEFD-----QPV-------------------- 144

  Fly   189 NENSPEIAQEKGSTGTDVATEE--PPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNS 251
                 ||:.|..:|.:||..||  .|:    ||.|:||.|.                        
  Fly   145 -----EISNEPDATDSDVNLEEIDLPD----EDGLESDHDL------------------------ 176

  Fly   252 PKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLV 316
            |.|:..|               ||.||.|...::.|..|...|:|::|:.|:.|.:.|:...:|.
  Fly   177 PNVQIHK---------------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELK 226

  Fly   317 RH-MNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTG 380
            .| :..||...|:.|.||...:.....:.||.|:||.|||:|||.|.:.||.:..||.|..:|..
  Fly   227 AHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQV 291

  Fly   381 EKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAED 424
            .:.:.||:|.:.|    .|:.|..||....|.:.:||..|.:.:
  Fly   292 VRKYSCDVCDRSF----SLKKHLATHFISNTHKRNAEAVTSSSE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 19/86 (22%)
COG5048 <264..411 CDD:227381 47/147 (32%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 5/20 (25%)
zf-H2C2_2 315..338 CDD:290200 8/23 (35%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 13/21 (62%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 7/23 (30%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 19/84 (23%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..261 CDD:275368 14/48 (29%)
zf-H2C2_2 255..278 CDD:290200 13/22 (59%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 8/26 (31%)
C2H2 Zn finger 297..313 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.